KEGG   Botrytis cinerea: BC1G_13074Help
Entry
BC1G_13074        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
bfu  Botrytis cinerea
Brite
Enzymes [BR:bfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     BC1G_13074
Transcription machinery [BR:bfu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     BC1G_13074
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 497 aa AA seqDB search
MAPQDIDSDLGKYWNTTGPRRPRTQLSRSSIEKAPNPTERTVSGESSLDSLTPSEESISD
FEDTDQEDTESNTVMGPNLQDTPKRKAGTEESLSNSQNAPKRKATEEPPSFPVSSKKMKM
SETELTENLKKANAEHPANINIIPFPEKVMIEEREGEIDFRVVNNDDTNESTIILSGLKG
IFQKQLPKMPKEYIARLVYDRNHLSMALVKKATLEVLGGITYRPFDDHEFAEIVFCAISS
DQQVKGYGAHLMNHLKDYVKASSKVMHFLTYADNYAIGYFKKQGFTKEITLPKPLWMGYI
KDYEGGTIMHCEMVPRVRYLESNRMIVKQKEVVNAKILAFSKSDEVHAPPKQWKNGAFPI
DPMSIPAIRASGWTPAMDELARQPRHGPNYAQLSRLLSSLQNHQKAWPFKAPVNGNEVAD
YYSVITNPMDFETMERKLDQDSYEKPEDFVADATLVFSNCKKYNNDSTPYAKCANKVEKY
MWSLIKEIPEWSYLLDN
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggctccccaagatatcgatagcgatttgggcaaatattggaatacaacaggccctaga
agaccacgtactcagttatcacggtctagcattgagaaagcacctaatcccacagaacgt
actgtgtcaggagaatcaagcctagactctctaacaccctcagaagaatcgatttcagat
ttcgaggacacggatcaagaagatactgaatccaacacagtcatgggtccaaatcttcaa
gatacaccaaaacgaaaagctggtacagaagagtcgctctcaaattcccaaaatgcgcca
aagcgaaaggctacagaggagccccctagttttcccgtatcttccaaaaagatgaaaatg
agtgaaaccgaattgaccgaaaatttaaagaaggcgaatgcagaacatcctgccaacatc
aacattataccttttccagaaaaagtgatgatcgaagaacgagagggtgaaattgatttt
cgagttgttaataatgacgatacgaatgagagtactataattctctcgggactgaaaggt
atttttcaaaaacaattgcccaaaatgccaaaggaatatattgctcgtctggtctatgat
cggaatcatttatctatggcgttggtaaagaaagcaacactggaagtattaggagggata
acatatcgaccatttgatgatcacgagtttgcggagattgttttttgtgctatatcatcc
gatcagcaagtcaaaggatatggtgcgcatctcatgaaccatctcaaagattatgtcaaa
gcttcttccaaagtcatgcatttcctcacctacgccgacaattatgccattggatacttt
aagaaacaaggatttaccaaagagattactctaccgaaacctctctggatgggttacatc
aaagattatgaaggtggaacaatcatgcattgtgaaatggttcccagagttcgttacctt
gagtcaaaccgcatgatcgttaagcaaaaggaggtagtcaatgcgaagattctcgccttt
agcaaatcagacgaagtccacgcaccacccaaacaatggaaaaatggcgcttttccaatc
gatcccatgtctatccccgccatccgcgcctctggttggacacccgccatggacgaatta
gctcgtcaacctcgccatggaccgaattatgcacaactttctcgccttttgagttcgctc
caaaatcaccagaaagcttggccattcaaagctcctgtcaatggaaatgaagttgcagat
tactactcggtaattacgaacccgatggattttgaaaccatggaaagaaaactcgatcag
gattcatatgagaagccagaagattttgtcgccgacgcaacgctagttttctccaattgt
aaaaaatacaacaacgattccacgccatatgcaaagtgtgcaaacaaggtggaaaaatac
atgtggagtctcatcaaagaaattccagagtggtcttatcttttggataattag

DBGET integrated database retrieval system