KEGG   Botrytis cinerea: BC1G_13536Help
Entry
BC1G_13536        CDS       T01072                                 

Definition
(RefSeq) hypothetical protein
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
bfu  Botrytis cinerea
Pathway
bfu00010  Glycolysis / Gluconeogenesis
bfu00052  Galactose metabolism
bfu01100  Metabolic pathways
bfu01110  Biosynthesis of secondary metabolites
bfu01130  Biosynthesis of antibiotics
Module
bfu_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1G_13536
   00052 Galactose metabolism
    BC1G_13536
Enzymes [BR:bfu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     BC1G_13536
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 5428497
NCBI-ProteinID: XP_001548030
AA seq 302 aa AA seqDB search
MPLDADFEFLPLGAIIQSFLVPTKDKSVNIVQSFPTAELYQKHNQPFFGETIGRVANRIS
NAKINSLNGKSYTLAQNNGVNALHGGVKGWGKRVWEGPKLVDGKEVRVLGMEYEVKLVDD
GKGVEETVVNVTNHSYFNLGGKSSIEGTQVTLCTNDYLPVDDGGIPTSGPKPYESITPNK
EFTLGPEEPNVDDCFVVDAESESTPLDTRSSPLTTLVKASHPDTGIHLEVLSTEPAFQFY
TGKYIDVPAVEGLEARGARSGFCVEPSRYVNAINEEKWRGQVLLKKGQVYGSRIVYKGWS
EV
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcctctcgatgcagatttcgaatttctccccttgggagccatcatccaaagcttcctc
gtccccacaaaagacaaatcggtgaatatcgtccaatcatttccaaccgcagagctctat
caaaaacacaatcagccgttttttggtgagacgatcggaagagtcgcgaatcgtatctcg
aatgcgaagatcaattctctgaacggaaaatcttatactcttgcgcagaacaatggggtg
aatgctttacatggtggtgtaaagggatggggtaaacgtgtttgggagggcccaaagttg
gtcgatggtaaggaagtcagagtgttgggtatggaatatgaagtcaagttggtggatgat
ggaaagggggtcgaggaaacagttgtcaatgtcacaaatcattcgtatttcaacctcggt
ggcaaatcgtcaattgaaggtacccaagtcacattatgtaccaacgactatctaccagtc
gacgatggaggtattcctacctccggcccaaagccatatgagagcattacacctaataag
gaatttacactgggccccgaggaaccaaatgttgatgactgcttcgtcgtagatgcggaa
tctgaatccactccccttgatacacgatcctcgcctctcactacattagtcaaagcttct
catccagacactggcatccatctggaagtcttgagtaccgaacccgcattccaattttat
actggaaaatacatcgatgtaccagcagttgagggacttgaggctcgaggggctagaagt
ggattctgtgttgagccaagtcgatatgtgaatgcaatcaacgaggagaaatggcgagga
caagtattgctcaagaagggacaagtttatggaagtaggattgtttataaggggtggtct
gaagtttaa

DBGET integrated database retrieval system