KEGG   Botryotinia fuckeliana: BC1G_13587Help
Entry
BC1G_13587        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
bfu  Botryotinia fuckeliana
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 572 aa AA seqDB search
MSNIPIIIKHQGKKYDIELDPSSNGETLKYQLYSLTGVEPERQKILVKGGQLKDDTDLSK
IGAKPGQTFLMMGTPAEGGTLSKPKEPIKFVEDMTEAEAAQQVGATPAGLQNLGNTCYLN
STLQTLRAIPELQDSLQKFTPTESGSNNMLNAFQLSRPQSLDLTAAMRDLYTQMSETQEA
FPPLIYLNALRQAFPQFQEKAKNGHGYAQQDAEEAWTQILQVLRSSLKIGEGGNTEGSSS
TPVSFVDKYMAGAFQSITECDEQGAKDAGEQPIKGSDVFLKLDCHITGATNHLRDGLVAG
LEEKIEKRSEVLGRDAIYTKKSKISRLPKYLTVHFVRFFWKREAQKKAKIMRKVTFPHEL
DVVEFCTDELKQMLIPVRDKVREVRKEEEDVERARKRQKRIHDKEEADKKAGLVDEAPSS
SKKDDKKESKSKDGDTEMEDVVYKTDAEIDAEKAASILEAKKELNALIDPELAKDDGANK
SGLYELRGIVTHQGSSADSGHYTSYVKKQGPLDRKTGVRGEEDGKWWWFNDDKVSEVDAE
KIATLAGGGESHSALILLYKAIPLPTAEGINQ
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatataccgatcattatcaagcatcagggcaagaaatatgatatcgagctcgat
ccttcgtccaacggcgaaacactaaaatatcagctctattctctcactggtgttgagcca
gaacgacaaaagatcttggttaaaggcgggcaacttaaagatgacaccgacctttcgaag
attggcgccaagccaggacagacatttttgatgatgggaacacctgcagagggaggaaca
ctttctaagccgaaggagccaataaagttcgttgaagatatgaccgaagcagaggctgca
caacaagttggcgcaacaccagctggattacaaaatttgggaaatacatgttatcttaac
tcaacattacaaactctcagagccattccagagttgcaagacagtctgcaaaagttcaca
ccaactgaatctggttccaacaacatgctcaatgcattccaactcagtcgaccccagtca
cttgacctgacagctgcgatgcgagatttatacacgcagatgtcagaaacacaagaggcg
tttccgccactcatttacctcaacgctctacgacaagctttcccacaatttcaagaaaag
gcgaagaatggccacggttatgcacagcaagatgctgaagaagcttggacgcaaattctc
caggtactgcgatcaagcttgaagattggtgaaggtggaaacactgaagggtcttcatct
acacctgtctcttttgttgacaaatatatggcgggggcattccagtccatcacagagtgt
gatgagcaaggtgcgaaggatgcaggcgaacaaccaatcaaggggagtgatgttttcttg
aagctggattgccatatcactggtgcaaccaaccatcttcgagatggactagtcgcagga
ttggaggaaaagattgaaaagagatctgaggtccttggtcgcgatgccatttacaccaaa
aaatccaaaatctcacgtcttcccaagtaccttactgtccatttcgttagattcttctgg
aaacgcgaggctcaaaagaaagcaaagattatgcgcaaggttacattccctcatgaactg
gacgttgtagaattctgtacagatgagctcaagcaaatgttgatcccagtcagggataag
gttcgtgaagtaagaaaggaagaggaagatgtcgaacgcgctcgcaagcgtcaaaagcgt
atccacgataaagaagaggccgacaaaaaagctggccttgtcgatgaagcaccatcttcc
tcaaagaaagatgacaagaaggagtctaagtctaaagacggcgataccgaaatggaggat
gttgtttataagactgacgcggagattgacgcggaaaaagcagcttcaattttggaggca
aagaaggagttgaatgcactaatcgacccagagcttgctaaggatgatggagctaacaag
tctggtctttacgaactccgtggtattgttacccatcaaggttctagtgcggatagtggt
cattacacttcatatgtgaagaagcaaggaccacttgaccgtaagactggtgtgcgtggc
gaggaagatggaaaatggtggtggttcaacgatgacaaggtttcagaggtcgatgctgag
aagattgctactcttgctggtggtggagaatctcactctgcactcatcttgctctacaag
gctatcccattacctactgctgaaggtatcaaccaataa

DBGET integrated database retrieval system