KEGG   Botryotinia fuckeliana: BC1G_13792Help
Entry
BC1G_13792        CDS       T01072                                 

Definition
acyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bfu  Botryotinia fuckeliana
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:bfu01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:bfu01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 467 aa AA seqDB search
MASNVSPPSSMAKTSEPNRNKKYDPKKPHITEEPITKANWYKHVNWLNVTLIVGVPIYGL
IMAYWTPLQWKTAVWAVLYYFMTGLGITAGYHRLWAHSSYSATLPLKIFLAAVGGGAVEG
SIRWWSRDHRAHHRYTDTDKDPYSVRKGLLYSHFGWMIMKQNPKRIGRTDISDLNDDPVV
VWQHRNYIKTVIFMGMVFPCLVTGLGWGDWFGGFIYAGILRIFFVQQATFCVNSLAHWLG
DQPFDDRNSPRDHVITALVTLGEGYHNFHHEFPSDYRNAIEWHQYDPTKWSIWMWKQLGL
AYDLKQFKSNEIEKGRLQQLQKKLDQKRQTLDWGIPLEQLPIIDWDTYQTEAKNGRALVA
VAGVIHDVTDFVKEHPGGKALITSGIGKDATAIFNGGVYNHSNAAHNLLSTMRVGVLRGG
CEVEIWKRAQRENKDISFVSDTAGQKIIRAGSQVTRIAEPVPSADAA
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgaacgtgtcaccaccttcgagcatggcgaagacttctgagcctaatcgcaac
aagaagtacgacccaaagaagcctcacatcaccgaggagcccattaccaaggcaaattgg
tacaaacacgttaactggcttaacgtcactctcattgtgggagtgcctatctatggtctc
atcatggcatactggactcctctgcagtggaagactgctgtctgggccgtcctttactac
tttatgaccggtttgggtattacagctggttaccacagactttgggcacattcctcatac
tctgccaccctcccattaaagattttcctcgcagccgttggaggtggagccgtcgaaggt
tccatcagatggtggtcaagagatcacagagctcatcacagatataccgataccgacaaa
gacccatactccgtacgaaaaggtctcctatactcccacttcggatggatgatcatgaag
caaaacccaaagcgtattggacgtaccgatatctccgatttgaacgatgacccagttgtc
gtttggcaacatcgcaactacatcaagaccgtcatcttcatgggtatggtcttcccatgt
ctcgtcactggtctcggttggggtgattggtttggtggtttcatctatgctggtatcctc
agaattttcttcgttcaacaagctactttctgtgtcaactctttggctcattggcttggt
gaccaacctttcgatgaccgcaactctcctcgtgatcacgtcatcactgctctcgttact
ctcggagaaggttaccacaacttccatcacgaattcccctccgattaccgtaatgctatc
gaatggcatcaatatgacccaaccaaatggtccatctggatgtggaagcaactcggtctc
gcctacgatcttaagcaattcaagtccaacgaaatcgagaagggccgtcttcaacaactc
caaaagaaactcgaccaaaagagacaaactcttgactggggtattcctcttgaacaatta
ccaatcatcgactgggacacttatcaaaccgaagccaagaatggacgtgctcttgttgct
gtcgctggtgttattcacgatgtcaccgatttcgtaaaggaacatccaggtggaaaggct
cttatcacatccggtattggcaaagacgcaactgctattttcaatggtggtgtctacaat
cattccaacgctgcccacaatcttctttcaactatgcgtgtaggtgtcctacgcggtgga
tgcgaagttgagatctggaagcgtgctcaacgtgagaacaaggatatttcttttgtcagt
gatacagctggtcaaaagatcatccgagctggtagccaggtaacccgcattgcggaacct
gttccatcagcagatgctgcataa

DBGET integrated database retrieval system