KEGG   Botrytis cinerea: BC1G_13845Help
Entry
BC1G_13845        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
bfu  Botrytis cinerea
Brite
Enzymes [BR:bfu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     BC1G_13845
Peptidases [BR:bfu01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   BC1G_13845
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 360 aa AA seqDB search
MTFNPNGDAIETVFYLNDTSNPEAFSTETWVSPDSKLGSSSTALLMSPDTRNVYSGTSLN
LTSHTISRPSGASMINNILTFTKLENKSEVMNALASKLGLSSALKFYDVCSLTEADSLKH
IPRPVYALLFSIPFTSTWETITRAKEMAKPPYKGSGPDEPAIWFKKAINGACGSMGLLHC
LLNGPAHEYILPNTILSRLYERSIPLGPDERATMLYNDQKFEDAHQAIAALVDKSSSAEN
IGKPRRHFVAFIRGEDGSLWEMDGSRGGPIRREPTLEEHEDLLTDDILKFCMAGFVDTNS
DEVSMCSCIALAKHPTEAVTLPLNSLSRGHLVNGRSEGVQPRTFWDPAWYGQDHWPPPSK
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgactttcaatccaaacggagatgccatagaaacggtgttttatcttaatgatacctcg
aatcctgaagctttctcgacagaaacatgggtatccccagattcaaaacttgggagttct
tcgacagcgctactgatgtcgccagatacgagaaatgtctattctggaacttctctgaat
ctgacttctcatacaatctcaagaccatcaggtgcgagcatgatcaataatatactaacc
tttaccaaacttgagaacaaatcagaagtgatgaacgcgctcgcctctaaacttgggctt
tcttctgctctcaagttttacgacgtatgttcacttaccgaagcggattcgctcaagcat
attccccgtccagtctatgctctcctattttccataccattcacgtctacttgggaaacc
attacgcgcgcaaaagaaatggcaaaaccaccttataaaggtagcggacctgatgagcct
gctatttggtttaaaaaagcaatcaatggtgcttgtggctctatgggtctcttacattgc
cttctaaatggaccggctcatgaatatattctccccaacactatactatctagactctat
gagcgatctattcccttaggacctgacgaacgagcaacgatgttatataacgatcaaaag
ttcgaagatgctcatcaggctattgctgctttggtcgataaatcatcatccgcagagaat
atcgggaagccgagacggcattttgtggcttttataaggggagaagacggatcgttgtgg
gaaatggatggaagtagagggggccctattcgtagggagccaacactggaagagcatgaa
gatcttttgactgatgatatattgaaattctgtatggcagggtttgttgataccaatagt
gatgaggtgagtatgtgtagttgcatcgcccttgctaaacatccaactgaggctgtaact
ttgcctttgaattctcttagtcgtggtcatttggtgaatggaaggagtgagggtgtacag
ccgcgtactttttgggacccagcttggtatggacaagatcattggcccccaccatcaaaa
tga

DBGET integrated database retrieval system