KEGG   Botrytis cinerea: BC1G_13863Help
Entry
BC1G_13863        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
bfu  Botrytis cinerea
Brite
Enzymes [BR:bfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     BC1G_13863
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 504 aa AA seqDB search
MTGPSQDKDSSVGTPVPKQKSKATIDTLGVGCIAMVQKDGALRRAEILSIKETKSGRQFY
CNFDNFNKRLDEWVPAIRIDFTQDVEWPAPEKPKEKSKAPPAGKKTIVGNKKNQKRPTQA
SKREDSVVSESGSNAPPWSEFAESQRQTPDADGDAKLTMALDLDATPEANDPMDVDEAAT
EAANAKNEPAQQFSPKEEIEKLRTSGSMTQNQAEISRIRNISKVQFGKFELYPWYFSPYP
EAFTQEDLMYICEFCLSYYGDLKAFTRHRGKCTLQHPPGNEIYRDDYVSFFEIDGRRQRT
WCRNLCLISKMFLDHKTLYYDVDPFLFYVMCSRDEKGFHLVGYFSKEKESADGYNVACIL
TLPQYQRKGYGRLLINFSYELSKIEGKLGSPEKPLSDLGLLSYRQYWTERIVEELLIHNE
KDERISIEGLSQKLNMTSADVEHTLQALKMQVYHKGEHKMVLPTALIKRHEAMREKQKLK
PKRVIDPSRIVWKPFKLVDRTWGW
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgacaggtccgtcgcaagataaagatagttctgtgggaactccagtacctaagcagaag
agtaaggcgacgattgatacattgggggtaggatgtatagcgatggtacagaaggatggt
gcacttagaagagcagaaattctgagtataaaagagacgaaaagtggtcgtcaattttat
tgcaatttcgataatttcaacaaacgtctagatgaatgggttcctgccataaggatagat
tttactcaagacgttgaatggccagctcccgagaaaccaaaggaaaagtcgaaagctcct
ccagctgggaaaaagaccatcgttggcaacaagaagaatcaaaaacgaccaactcaagca
agcaagagagaagattctgtagtctcagaatccggttcaaatgctcctccatggtctgaa
tttgcggagtctcaaagacagactccggatgctgatggagatgcaaaactcaccatggca
ttagaccttgatgctacgcctgaagccaacgatcctatggatgtcgatgaagctgctact
gaagcagcaaatgcaaagaatgaacctgctcagcaattcagtccaaaagaagaaatcgaa
aaattacgcacaagtggttcgatgactcaaaatcaagccgagatatcacgtattcgaaat
atttccaaagtgcaattcggtaaattcgaactttacccctggtatttctccccataccct
gaagcatttactcaagaagatctcatgtacatctgtgaattttgtttgtcttattacgga
gacctcaaagccttcactcgtcatcgaggcaagtgtacgttacaacaccctcccggaaat
gaaatttatcgggatgactacgtctctttcttcgaaatcgatggtcgacgtcaacgaact
tggtgtcgaaacttgtgcctcatatccaagatgtttctggatcacaaaactctttactac
gacgtggatcctttcttgttttatgtcatgtgctcacgggacgagaaagggtttcattta
gtgggatatttctcaaaagaaaaggaaagtgcggatggttataacgtagcttgtattctg
acacttccgcaatatcaacgtaaaggttacgggagactcctaatcaatttctcctatgag
ctctcgaagatcgaaggaaagctcggttcgcccgaaaaacccctatccgatctcggtctt
ctctcatatcgacaatattggaccgaacgcattgttgaagagcttttgattcataatgaa
aaagacgagagaattagtatagaaggtttatcgcaaaagctcaatatgacgagtgctgat
gtagaacatacgttacaggcgctgaagatgcaggtttatcataagggagaacacaagatg
gttttgccgacggcattgatcaagagacatgaggcgatgagggaaaagcagaaattaaag
ccgaagagggtgatcgatccttcaaggattgtttggaaaccgtttaagttggtggataga
acgtggggttggtag

DBGET integrated database retrieval system