KEGG   Botrytis cinerea: BC1G_13966Help
Entry
BC1G_13966        CDS       T01072                                 

Definition
mitogen-activated protein kinase
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
bfu  Botrytis cinerea
Brite
Enzymes [BR:bfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     BC1G_13966
Protein kinases [BR:bfu01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   BC1G_13966
Exosome [BR:bfu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BC1G_13966
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 327 aa AA seqDB search
MTARAPNPASGSRKISFNVSEQYDIQDVVGEGAYGVVWYATPLCYSCNLSNGGRPWNLQK
MEINYESFTEVYLIQELMETDMHRVIRTQDLSDDHCQYFIYQTLRALKAMHSANVLHRDL
KPSNLLLNANCDLKVCDFGLARSAASQEDNSGFMTEYVATRWYRAPEIMLTFKEYTKAID
VWSVGCILAEMLSGKPLFPGKDYHHQLTLILDVLGTPTMEDYYGIKSRRAREYIRSLPFK
KKVPFKTMFPKTSDLALDLLEKLLAFNPVKRITVEEALKHPYLEPYHDPEDEPTANPIPE
EFFDFDKNKDNLTKEQLKKLIYDEIMR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgacagctcgtgcgcctaatcccgcctcgggatcacgaaagatctctttcaatgtcagc
gagcaatatgatatccaggatgttgtaggagaaggagcttatggtgttgtctggtatgct
accccactttgttactcttgcaatctctcgaatggaggcagaccatggaacttgcagaaa
atggagataaactatgagtccttcacagaagtttaccttatccaggaactcatggagacc
gatatgcatcgtgtaattcgcacccaagatttatccgacgaccattgccaatactttatc
tatcaaaccctgcgagccttgaaagccatgcactccgcaaatgttctacacagagatttg
aaaccatctaatctgttactcaatgccaactgcgatttgaaggtctgcgattttggtctt
gctagatcggctgcatcccaagaagataactctggtttcatgacagaatatgttgcgacc
agatggtaccgtgctccagagattatgttgacgttcaaggagtacaccaaggctattgat
gtctggtctgttggatgtatcttggccgagatgttaagcggaaagcccctgttccctgga
aaggattatcaccaccaactcacactcattcttgacgttcttggtactccaaccatggaa
gattactacggtatcaaatctcgtcgtgcaagagaatatatccgatcgttgccattcaag
aagaaggttcctttcaagaccatgttcccaaagacctcagatctcgctttggacctcctc
gagaagcttctcgcttttaacccagtcaagagaatcactgtcgaagaagcactgaagcac
ccataccttgaaccataccacgatcccgaagatgagccaaccgccaatcccattccagaa
gaattctttgatttcgataaaaacaaggacaacctcaccaaggaacaactcaaaaaattg
atttatgatgagatcatgagatag

DBGET integrated database retrieval system