KEGG   Botryotinia fuckeliana: BC1G_13966Help
Entry
BC1G_13966        CDS       T01072                                 

Definition
mitogen-activated protein kinase
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
bfu  Botryotinia fuckeliana
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 327 aa AA seqDB search
MTARAPNPASGSRKISFNVSEQYDIQDVVGEGAYGVVWYATPLCYSCNLSNGGRPWNLQK
MEINYESFTEVYLIQELMETDMHRVIRTQDLSDDHCQYFIYQTLRALKAMHSANVLHRDL
KPSNLLLNANCDLKVCDFGLARSAASQEDNSGFMTEYVATRWYRAPEIMLTFKEYTKAID
VWSVGCILAEMLSGKPLFPGKDYHHQLTLILDVLGTPTMEDYYGIKSRRAREYIRSLPFK
KKVPFKTMFPKTSDLALDLLEKLLAFNPVKRITVEEALKHPYLEPYHDPEDEPTANPIPE
EFFDFDKNKDNLTKEQLKKLIYDEIMR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgacagctcgtgcgcctaatcccgcctcgggatcacgaaagatctctttcaatgtcagc
gagcaatatgatatccaggatgttgtaggagaaggagcttatggtgttgtctggtatgct
accccactttgttactcttgcaatctctcgaatggaggcagaccatggaacttgcagaaa
atggagataaactatgagtccttcacagaagtttaccttatccaggaactcatggagacc
gatatgcatcgtgtaattcgcacccaagatttatccgacgaccattgccaatactttatc
tatcaaaccctgcgagccttgaaagccatgcactccgcaaatgttctacacagagatttg
aaaccatctaatctgttactcaatgccaactgcgatttgaaggtctgcgattttggtctt
gctagatcggctgcatcccaagaagataactctggtttcatgacagaatatgttgcgacc
agatggtaccgtgctccagagattatgttgacgttcaaggagtacaccaaggctattgat
gtctggtctgttggatgtatcttggccgagatgttaagcggaaagcccctgttccctgga
aaggattatcaccaccaactcacactcattcttgacgttcttggtactccaaccatggaa
gattactacggtatcaaatctcgtcgtgcaagagaatatatccgatcgttgccattcaag
aagaaggttcctttcaagaccatgttcccaaagacctcagatctcgctttggacctcctc
gagaagcttctcgcttttaacccagtcaagagaatcactgtcgaagaagcactgaagcac
ccataccttgaaccataccacgatcccgaagatgagccaaccgccaatcccattccagaa
gaattctttgatttcgataaaaacaaggacaacctcaccaaggaacaactcaaaaaattg
atttatgatgagatcatgagatag

DBGET integrated database retrieval system