KEGG   Botrytis cinerea: BC1G_14799Help
Entry
BC1G_14799        CDS       T01072                                 

Definition
(RefSeq) hypothetical protein
  KO
K06634  cyclin H
Organism
bfu  Botrytis cinerea
Pathway
bfu03022  Basal transcription factors
bfu03420  Nucleotide excision repair
Module
bfu_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    BC1G_14799
  Replication and repair
   03420 Nucleotide excision repair
    BC1G_14799
Transcription machinery [BR:bfu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     BC1G_14799
DNA repair and recombination proteins [BR:bfu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     BC1G_14799
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_C_2 Cyclin_N UPF0565
Motif
Other DBs
NCBI-GeneID: 5427315
NCBI-ProteinID: XP_001546847
AA seq 380 aa AA seqDB search
MSNEDARYRTSTQYRHWSYTPSALRSLRESTNALATTQVRDAVRRAREARAASSNDNSEA
ENSRSASTALPDGDVDCLTVDEELKLLDYYCRQTLQLGDHLGVPIEVKATAIQYIRRFYI
SHSLMTYTPTTILKTGLFFATKTENHYFRITRFASDIGKTTTEEILSSEFLLTQGLRFQF
DIRHPYRGLEGAIMELLAISTHKIPIPAELEPQRPENMHNLTLESHGRARHYLKTSALLC
DSYFHYTPSQIMFASLYLASAPLATFYLALKSYNPSNPDTNTATSTYQKLLTLIKNLAQT
LSSIPEEQTPEQRQEIQALVKKLKKCRNPEKADLVGLQKMKREGAEGKDGEDEEKIIKKR
KMEREQRLKEEQDLFGGSLK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgaagacgcccgctatcgtacttctactcagtatcgtcactggtcatacaca
ccgtccgcactccgttccctacgcgaaagcacaaatgccctagctacaacccaagttcga
gatgccgttcgacgcgccagagaagctcgtgctgcatcctcaaatgataatagtgaagca
gagaatagcaggtctgctagtactgcgctaccggatggagatgtggattgtttgacggtg
gatgaggaattgaagttgttggattattattgtagacagacgctacagctgggggatcat
ttgggtgtgccgattgaggtcaaggccacagcaattcaatacatccgccgcttctacata
agtcacagtctaatgacctatacacccactaccattctaaaaaccggtctcttcttcgcc
accaagacagaaaaccactatttccgcatcaccagattcgcgagcgacataggcaaaaca
accaccgaagagattctgtcctcagaatttcttttaacccaaggcctccgcttccagttt
gacatccgccacccctaccgcggtctcgaaggagccatcatggaactcctcgccatctcc
acccacaaaattcccatccccgcagaactcgaaccccaaagacccgaaaatatgcacaat
ttaacattagaaagccacggacgcgcgcgtcattatctgaaaacaagcgcgctactatgt
gattcctatttccactacacgccctcacaaataatgttcgcatccctctatctcgcttcc
gcccctttagccactttctacctcgcgctaaaatcctacaacccttcgaatccagataca
aacaccgcaacatctacctaccaaaaactcctcaccctaattaaaaatctcgctcaaaca
ctctcctcaatccccgaagaacaaacccccgaacaaagacaagaaatccaagccctagtt
aagaaattaaagaaatgcaggaatcccgaaaaggcagatttagtcgggctgcaaaaaatg
aaaagggagggagcagagggtaaagatggagaagatgaagagaagattatcaagaagagg
aagatggagcgggagcagagattaaaagaagagcaagatttatttggcgggagtttgaaa
tga

DBGET integrated database retrieval system