KEGG   Botryotinia fuckeliana: BC1G_14799Help
Entry
BC1G_14799        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
bfu  Botryotinia fuckeliana
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:bfu03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:bfu03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 380 aa AA seqDB search
MSNEDARYRTSTQYRHWSYTPSALRSLRESTNALATTQVRDAVRRAREARAASSNDNSEA
ENSRSASTALPDGDVDCLTVDEELKLLDYYCRQTLQLGDHLGVPIEVKATAIQYIRRFYI
SHSLMTYTPTTILKTGLFFATKTENHYFRITRFASDIGKTTTEEILSSEFLLTQGLRFQF
DIRHPYRGLEGAIMELLAISTHKIPIPAELEPQRPENMHNLTLESHGRARHYLKTSALLC
DSYFHYTPSQIMFASLYLASAPLATFYLALKSYNPSNPDTNTATSTYQKLLTLIKNLAQT
LSSIPEEQTPEQRQEIQALVKKLKKCRNPEKADLVGLQKMKREGAEGKDGEDEEKIIKKR
KMEREQRLKEEQDLFGGSLK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgaagacgcccgctatcgtacttctactcagtatcgtcactggtcatacaca
ccgtccgcactccgttccctacgcgaaagcacaaatgccctagctacaacccaagttcga
gatgccgttcgacgcgccagagaagctcgtgctgcatcctcaaatgataatagtgaagca
gagaatagcaggtctgctagtactgcgctaccggatggagatgtggattgtttgacggtg
gatgaggaattgaagttgttggattattattgtagacagacgctacagctgggggatcat
ttgggtgtgccgattgaggtcaaggccacagcaattcaatacatccgccgcttctacata
agtcacagtctaatgacctatacacccactaccattctaaaaaccggtctcttcttcgcc
accaagacagaaaaccactatttccgcatcaccagattcgcgagcgacataggcaaaaca
accaccgaagagattctgtcctcagaatttcttttaacccaaggcctccgcttccagttt
gacatccgccacccctaccgcggtctcgaaggagccatcatggaactcctcgccatctcc
acccacaaaattcccatccccgcagaactcgaaccccaaagacccgaaaatatgcacaat
ttaacattagaaagccacggacgcgcgcgtcattatctgaaaacaagcgcgctactatgt
gattcctatttccactacacgccctcacaaataatgttcgcatccctctatctcgcttcc
gcccctttagccactttctacctcgcgctaaaatcctacaacccttcgaatccagataca
aacaccgcaacatctacctaccaaaaactcctcaccctaattaaaaatctcgctcaaaca
ctctcctcaatccccgaagaacaaacccccgaacaaagacaagaaatccaagccctagtt
aagaaattaaagaaatgcaggaatcccgaaaaggcagatttagtcgggctgcaaaaaatg
aaaagggagggagcagagggtaaagatggagaagatgaagagaagattatcaagaagagg
aagatggagcgggagcagagattaaaagaagagcaagatttatttggcgggagtttgaaa
tga

DBGET integrated database retrieval system