KEGG   Botrytis cinerea: BC1G_15125Help
Entry
BC1G_15125        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
bfu  Botrytis cinerea
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    BC1G_15125
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BC1G_15125
Enzymes [BR:bfu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     BC1G_15125
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 686 aa AA seqDB search
MAAIPALNYPITGPPKPSPAPADGKATLLCTVHFAKFSGSVPLRREIRDLQHNFPDQWTL
YILGLQAFQQLDEKSDLSWYGIAGIHGRPYRPWGGVQGDNPAGWQGYCTHSSILFAPWHR
PYLALFEQYLYQIIQKIAATFPTSTKARYQQAALTFRMPYWDWAAAPPAGDKYFPTVVGQ
PLIQIITPTSNNKPVQINNPLYSYKFNPLNPLKGDFPSAPESRWPTTLRYPTSGSATAKS
QEQQVFDAMESQFDSYQSNVYLIMRDPNYKQFDAFSNHQWASNNAPGTYGSIEDVHNSVH
SETGGNGQMGDPDYAAFDPLFWGHHTNVDRQFAIWQALNPNSYAINKPSGDGTFSIQSGS
QETSTTPLTPFNNATGKTYWTSEGVRSTATFNYAYPETQQWKYPTAQQYQTSVLVAVQTL
YGATSNQFMQLMGVQTAAAPEQISTQAENIVAGSSNAAQKPTGNGAASSSDGHNFLSNLL
HSSAKAKPKPGDAIRGGEDFESEIGKPSEAPAAAEPIKYREYICNIRAPKHILHQTYRVR
IFLGDFNSDPATWATEQSTIGTFSSFGKNPETTGCGKCIKDEARSLMISGTVPLTPILLK
LYKNGDLGSLEVENVIPYLRQNLHWRVTLADGTEIDRGDVEGLKISVVSTEVRCAQGGFP
EYSGEYEVHSEVTGGRPAGLGEGDRI
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atggctgccatcccggcacttaactaccctatcaccggccctccaaagccttctcctgct
cctgctgacggtaaggctacacttctgtgtactgttcattttgctaaattctcaggatct
gttcccttgaggcgtgagattcgtgatctccaacataactttcctgaccaatggacgctt
tacatactcggtcttcaggcctttcaacaacttgacgagaagtcagatttatcatggtat
ggaatcgcgggtattcatggacgcccctatcgtccctggggtggggtacaaggagataac
ccggctggatggcagggctactgcacccacagctccattctctttgcaccatggcatcgt
ccgtaccttgcattgtttgagcaatacctgtatcaaatcatacaaaagatcgctgctacg
ttccccacttccacaaaggcccgttatcaacaagctgccctgactttccgtatgccatac
tgggactgggctgctgcaccccccgctggtgataagtactttcctactgttgttggacag
ccattgatccaaatcattactccaacctcgaataataagccagttcaaatcaataatcca
ctctactcctacaaattcaacccattgaatcctttaaagggtgatttccctagtgctccg
gaatcacgatggccaaccactcttcggtatccaaccagtggaagtgcaaccgccaaatct
caagagcaacaggtctttgacgctatggaatcacaatttgattcgtaccaaagtaatgtt
tacttgatcatgagagaccccaattataagcagtttgatgcctttagcaatcaccaatgg
gcatcaaacaatgctccgggaacatatggtagtatcgaagatgtgcacaacagtgttcat
agtgaaactggtgggaatggacagatgggcgatcctgattatgcagcatttgatccattg
ttctgggggcatcacaccaatgtcgatcgtcaatttgccatctggcaagcattaaacccc
aacagctatgcaatcaacaagccttccggcgatggaacattttccatccaaagtggtagc
caagaaacaagcactacccccttgacgccattcaacaatgccactgggaaaacctactgg
acttccgaaggtgtgcgtagtacagccacgttcaactacgcctaccccgagactcaacaa
tggaagtatcctactgcccagcaatatcaaacgagtgttctcgtcgcagtgcagacattg
tatggagctactagtaaccaattcatgcaattgatgggcgtacaaactgctgctgcacca
gaacaaatttctacccaggccgaaaatattgttgcaggtagcagtaatgcagctcagaaa
cctaccggtaatggtgctgcatcatcttctgacggacacaactttttgtcaaatcttctt
cacagttccgccaaggccaagccaaagcctggtgacgccattagaggtggagaggacttt
gagtccgagattggaaaaccatctgaagctcctgccgccgcggaaccaatcaaataccgt
gaatacatttgcaatatccgtgctcccaagcatattctccatcaaacctatcgagtccga
atcttccttggagatttcaattccgatcctgcaacttgggcaaccgagcaatccaccatt
ggcaccttctcttcctttggtaaaaatcccgaaaccaccggatgcggaaaatgcatcaaa
gacgaagcacgttccctcatgatctccggcaccgttcctttaacccccatcctcctcaaa
ctgtacaagaatggcgatctcggatctctcgaagtcgagaatgtcattccgtatttgaga
caaaatctccattggagagttacactcgctgatgggactgagattgacaggggagatgtt
gagggacttaagattagtgtggtgagtacagaggtgaggtgtgcgcagggagggttcccg
gagtatagtggggagtatgaggtgcatagtgaggttacaggaggaagaccagccggttta
ggagagggagataggatttag

DBGET integrated database retrieval system