KEGG   Botryotinia fuckeliana: BC1G_15126Help
Entry
BC1G_15126        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
bfu  Botryotinia fuckeliana
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bfu00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 420 aa AA seqDB search
MRTVLCKWACLPTLKGTHQDCGFYATAFLNVKFKVETTLEPIALLNELQAIENEMGRMKI
IDKGPRNIDLDILLYENEVVDHPRLQIPHPGMAERELIPGQPLNPKSPWKFTQDYLNELP
PSPTPLSTITPLHASTGSLHALKKNRQTHVMAILNMTPDSFSDGGKNLNERNFLRTKSSQ
LIEVGATIIDIGGQSTAPGAPEVSSEEEINRVLPAIQEIRNTKSPKTVTISIDTYRASVA
RAAVEAGADIINDVSSGQLDPEMLPTMAQLGKTVCLMHMRGTPATMNTLTDYEPEGLIPT
IAKELLERVAEAEAAGIRRWRIILDPGIGFAKTQNQNLEILRRMDELRDWPGLQGLPWLL
GASRKKFIGKITGVDSPSERDWGTAATVTAAIQGGADIVRVHSVEKLARVAKMSDAIYRV
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgcgtactgttctttgcaagtgggcatgtctaccaactttgaagggtactcatcaagat
tgtggtttttacgcaaccgcattcttgaatgtcaagttcaaggtagaaacaaccttggaa
ccgattgctttattaaatgagctccaagccatcgaaaatgagatgggccgaatgaagatt
attgataaaggcccaagaaatattgaccttgacattctactttacgagaatgaggtcgta
gatcacccaagattacagatacctcatcctggtatggctgagcgggagcttattcctgga
caacccttgaatccgaaatctccatggaagtttacccaggattatttaaatgaattgccg
ccatccccaactcctttatctaccattactccattgcatgcatccactggttcattgcat
gctcttaaaaagaaccggcaaacccatgtaatggcaattctgaatatgacacccgactct
ttctccgatgggggcaaaaatctcaacgagagaaattttctacgaaccaaatcctcacaa
ttgattgaagtcggagcaactatcattgatattggtggtcaatcaaccgcaccgggtgct
cccgaggtatcttctgaggaggaaatcaatcgcgttttaccagctatccaagagattaga
aatactaaatcacccaagaccgtaacaattagtatcgatacctacagggcatctgtagct
agggctgctgttgaagcaggtgcggatatcattaatgatgtctcttcaggtcaacttgat
cctgaaatgctaccaaccatggcccaactcggaaaaactgtatgtcttatgcacatgaga
ggaacgccggcaactatgaatactctcacagactatgagcccgaaggcctcattccgact
attgcaaaagagttactagaacgagtagcagaagcagaggctgctggtattcggcgatgg
cgtataattctagatcctggaattggatttgcgaaaacacaaaatcagaatcttgaaata
ctccgtcggatggacgaattgcgtgattggcccggcctacaaggcttgccatggctatta
ggggccagtcgaaaaaagtttattggtaaaatcacgggagttgatagcccgagcgaaaga
gactggggtactgcggcgacagtgactgcagcgattcaaggcggagctgacatcgtgaga
gtacattctgtagagaagttagctagggttgctaagatgtcggatgccatatacagagtt
tga

DBGET integrated database retrieval system