KEGG   Botryotinia fuckeliana: BC1G_15413Help
Entry
BC1G_15413        CDS       T01072                                 

Definition
serine / threonine protein phosphatase type 1
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
bfu  Botryotinia fuckeliana
Pathway
mRNA surveillance pathway
Meiosis - yeast
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:bfu03015]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:bfu04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 308 aa AA seqDB search
MAEPEVDLDSIIDRLLEVRGSRPGKQVQLLEQEIRYLCTKAREIFISQPILLELEAPIKI
CGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFIL
RGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSPDLN
SMEQIRRVMRPTDIPDCGLLCDLLWSDPDKDITGWSENDRGVSFTFGPDVVSRFLQKHDM
DLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAEK
KQNRFGRR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaccagaagtcgatctcgactctatcatcgatagactgctagaagtcagaggc
agcagaccaggcaaacaagtacagcttttggaacaagaaattcgttatctttgcaccaag
gctcgcgaaattttcatctctcaacccatcctcttagagctcgaggcaccaatcaagatc
tgtggtgatattcacggtcaatactacgatctcctccgtttgttcgaatacggtggattc
cctcccgaggctaactacctcttccttggtgattatgttgatagaggcaaacagtccctc
gagactatctgtttgctcttagcatacaaaatcaaatacccagaaaacttcttcatcctc
cgcggtaaccacgagtgtgcctccatcaacagaatctacggtttctacgacgagtgcaag
agaagatacaacatcaagctatggaagacatttactgattgtttcaactgcctccccatt
gcagcaatcattgacgaaaaaatcttcactatgcacggtggtttgagtccagatttgaac
tccatggagcaaatccgtcgtgtcatgcgaccaactgatattcctgattgcggtctcctt
tgcgatcttctctggtccgatccagacaaggatatcaccggctggagcgagaacgatcgt
ggtgtatccttcacattcggtcccgatgttgtttctaggttcctacaaaagcatgatatg
gatttgatatgtagagctcaccaagtcgtcgaggatggttacgagttcttctcaaagcgg
caattggtaacactcttcagtgcgcccaattactgtggagagtttgacaatgccggagcg
atgatgagtgtggatgagagtttgctatgttcattccagattttaaaaccagcggagaaa
aaacaaaacaggttcggacgcagataa

DBGET integrated database retrieval system