KEGG   Botrytis cinerea: BC1G_15413Help
Entry
BC1G_15413        CDS       T01072                                 

Definition
serine / threonine protein phosphatase type 1
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
bfu  Botrytis cinerea
Pathway
mRNA surveillance pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    BC1G_15413
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    BC1G_15413
Enzymes [BR:bfu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     BC1G_15413
Protein phosphatases and associated proteins [BR:bfu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     BC1G_15413
Transcription machinery [BR:bfu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     BC1G_15413
Spliceosome [BR:bfu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    BC1G_15413
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 308 aa AA seqDB search
MAEPEVDLDSIIDRLLEVRGSRPGKQVQLLEQEIRYLCTKAREIFISQPILLELEAPIKI
CGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFIL
RGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSPDLN
SMEQIRRVMRPTDIPDCGLLCDLLWSDPDKDITGWSENDRGVSFTFGPDVVSRFLQKHDM
DLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAEK
KQNRFGRR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaccagaagtcgatctcgactctatcatcgatagactgctagaagtcagaggc
agcagaccaggcaaacaagtacagcttttggaacaagaaattcgttatctttgcaccaag
gctcgcgaaattttcatctctcaacccatcctcttagagctcgaggcaccaatcaagatc
tgtggtgatattcacggtcaatactacgatctcctccgtttgttcgaatacggtggattc
cctcccgaggctaactacctcttccttggtgattatgttgatagaggcaaacagtccctc
gagactatctgtttgctcttagcatacaaaatcaaatacccagaaaacttcttcatcctc
cgcggtaaccacgagtgtgcctccatcaacagaatctacggtttctacgacgagtgcaag
agaagatacaacatcaagctatggaagacatttactgattgtttcaactgcctccccatt
gcagcaatcattgacgaaaaaatcttcactatgcacggtggtttgagtccagatttgaac
tccatggagcaaatccgtcgtgtcatgcgaccaactgatattcctgattgcggtctcctt
tgcgatcttctctggtccgatccagacaaggatatcaccggctggagcgagaacgatcgt
ggtgtatccttcacattcggtcccgatgttgtttctaggttcctacaaaagcatgatatg
gatttgatatgtagagctcaccaagtcgtcgaggatggttacgagttcttctcaaagcgg
caattggtaacactcttcagtgcgcccaattactgtggagagtttgacaatgccggagcg
atgatgagtgtggatgagagtttgctatgttcattccagattttaaaaccagcggagaaa
aaacaaaacaggttcggacgcagataa

DBGET integrated database retrieval system