KEGG   Botryotinia fuckeliana: BC1G_15520Help
Entry
BC1G_15520        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bfu  Botryotinia fuckeliana
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bfu00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 413 aa AA seqDB search
MKLFIFKSLSLLAACGGFLPTFVVGHQHDEIAQQHLNPEELRLGKVDGSVSKEEKQELEK
LWGFEWSFSGISTFAHLEYKKCLTTPEELFDIGILGVPFDTAVSYRPAARFGPKAIRAAS
ARQTSFRGFNTRGGLNPYTSFARILDCGDIPVTPLNNAVALEQMTAAYTELLNRKPLSSS
LSRPKIISLGGDHSLALAALRALHQVYNQPIAVLHFDAHLDTWHPAKYPDPWASKQAQFN
HGSMFWLASNEGLIMNGSSVHAGLRTRLSGDDFADYEDDDRQGFLRISADDIDDLRPQGV
AKKIMDRIGTEVPVYLSIDIDVLDPGVAPGTGTPEPGGWTMRELIRILRGIEGLNVVGAD
IVEVSPSYDGIGEETALSGAQVAFEMLTSIVKRGLRDMGKVTEVKEIRKKEEL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcttcattttcaagtcgctgtcattattggcagcatgtgggggttttctacca
acttttgtggtggggcatcagcatgatgaaatagcgcagcaacatttgaatccggaggaa
ttgagacttggaaaggtcgatggaagtgtgagcaaggaagaaaagcaagaattggagaaa
ctttggggattcgagtggtctttttcaggaatctcgacatttgcccatcttgaatacaaa
aaatgcctcactacccccgaagaacttttcgacataggaattctaggtgttccattcgac
acggcagtcagctatcgacctgcggctagatttggacccaaagctattcgagcagccagt
gcgagacaaactagctttagaggattcaatacgagaggtggattaaatccatacacatcg
tttgctcgcattcttgattgtggagatataccggtaactcccttgaataatgccgtggca
ttagaacaaatgacggcagcttacaccgaactcctcaaccggaagcccctctcctcatca
ctttcccgcccaaaaatcatctctctaggaggtgaccatagtctagcactagcagctctt
cgggctctccatcaggtctacaatcaaccaatcgccgtcctccacttcgacgcccatctc
gatacatggcatcctgccaaatatccagatccatgggcaagtaagcaagcgcaattcaat
catggtagtatgttttggctcgcttcaaatgaagggttaatcatgaacggtagtagcgtt
catgctgggttgagaacacgattaagtggtgatgatttcgcggattatgaggatgatgat
aggcaaggctttttgagaatttccgcggatgatattgatgatcttagacctcaaggcgtg
gcaaagaagattatggacagaattggaacggaagttccggtttatcttagtattgatatt
gatgttttggatcccggcgtagcaccagggacagggacgcctgagcctggtggatggacg
atgagggagttgattagaatattaagggggatagagggattgaatgttgtgggtgcggat
atcgtggaggttagtccaagctatgatgggattggggaagaaactgcactcagtggtgcg
caggtggctttcgagatgttgacgagtattgtcaagagaggtttgagggatatggggaag
gttacagaagttaaagaaataaggaagaaggaggagctgtaa

DBGET integrated database retrieval system