KEGG   Botryotinia fuckeliana: BC1G_15819Help
Entry
BC1G_15819        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bfu  Botryotinia fuckeliana
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bfu01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bfu00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 416 aa AA seqDB search
MKPPKSLTIVIKLGTSSIVDEKTHEPLLSILSLIVETAVRLHKDGHKVIIVSSGAIGVGL
RRMDLDKRPKHLPRVQALAAIGQCRLISLWDSLFAHLQQPVAQILLTRNDIADRTQYRNA
QNTLHELLEMGVIPIVNENDTLAVAEIKFGDNDTLSAITAAMLHADYLFLMTDVDCLYDK
NPRTHPDAQAIEVVEDISALQADVSSAGSSLGTGGMSTKIVAARLATSAGVTTVITRSSS
PGNIASIVSYVQSLKHSTSGGKTGDVVSQSQTPETITRSNSTLSLTGVASSPVEPPLHTR
FLPSHQPIRDRYFWLLHGLSPHGTIYIDAGAHRALAAKAGLLPAGIVDVEGSFAQQEAVR
LVVVDRPSSPDTKIVSGSGVEVGRALVNYSAMEITRIKGMRSSEIHGLLGYADSEI
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccccaaaatccttaactatagttataaaattaggaaccagttccatcgtggat
gagaaaactcatgagccgttgttgagtattttgagtttaattgtggaaactgctgtgagg
cttcacaaagatggacacaaagttattattgtatcctccggagccattggggttggactt
cgaagaatggacttggataagaggccaaaacatcttccccgagtacaagctttagcagca
ataggacagtgtcgccttataagtctatgggatagcttgttcgctcacttgcaacaacct
gttgcacaaattttactcacaagaaatgatatcgcagatcgaacccaataccgaaatgct
cagaatacgttacacgagcttctagaaatgggcgtcatccctatcgttaacgagaacgat
actctagctgtagctgaaatcaaatttggagacaatgatactctatctgcaatcactgca
gctatgctccatgcagattacttgttcctgatgactgatgtcgattgtctctatgataaa
aatcctcgaacgcatccagatgcacaagcaattgaggtcgttgaagacatctccgcatta
caggccgatgtatcaagtgccggctctagcctcggtacaggaggaatgtccacaaaaata
gttgctgcccgtctcgccacctccgcaggtgtaacaactgtcataacacggtcctctagc
ccagggaacattgcaagtattgtaagctatgttcaatccctcaaacattctacttcaggc
ggcaaaaccggtgatgttgtttcgcaatcgcagacaccggaaactattacaagatccaat
tccacactgtcccttactggtgtagcatcatcacccgtggagccgcctctgcatacccgg
tttcttccatcgcatcaaccgatccgggaccgctatttctggcttctacatggcctctct
ccacatggaacgatttatattgatgctggcgctcatcgagcattggcggccaaagctggt
ctgcttcctgccgggatcgtagatgtggagggcagctttgcccaacaagaagctgtgcgt
ctagtagttgttgaccgtccaagctcgccagatacaaagattgtatcagggtctggagtt
gaagtgggtagggcgctagtgaactacagtgcaatggagataactaggattaaaggtatg
agaagtagtgaaatacacggattattgggctatgcagatagtgagatttaa

DBGET integrated database retrieval system