KEGG   Botrytis cinerea: BC1G_15819Help
Entry
BC1G_15819        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bfu  Botrytis cinerea
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BC1G_15819
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BC1G_15819
Enzymes [BR:bfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BC1G_15819
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 416 aa AA seqDB search
MKPPKSLTIVIKLGTSSIVDEKTHEPLLSILSLIVETAVRLHKDGHKVIIVSSGAIGVGL
RRMDLDKRPKHLPRVQALAAIGQCRLISLWDSLFAHLQQPVAQILLTRNDIADRTQYRNA
QNTLHELLEMGVIPIVNENDTLAVAEIKFGDNDTLSAITAAMLHADYLFLMTDVDCLYDK
NPRTHPDAQAIEVVEDISALQADVSSAGSSLGTGGMSTKIVAARLATSAGVTTVITRSSS
PGNIASIVSYVQSLKHSTSGGKTGDVVSQSQTPETITRSNSTLSLTGVASSPVEPPLHTR
FLPSHQPIRDRYFWLLHGLSPHGTIYIDAGAHRALAAKAGLLPAGIVDVEGSFAQQEAVR
LVVVDRPSSPDTKIVSGSGVEVGRALVNYSAMEITRIKGMRSSEIHGLLGYADSEI
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccccaaaatccttaactatagttataaaattaggaaccagttccatcgtggat
gagaaaactcatgagccgttgttgagtattttgagtttaattgtggaaactgctgtgagg
cttcacaaagatggacacaaagttattattgtatcctccggagccattggggttggactt
cgaagaatggacttggataagaggccaaaacatcttccccgagtacaagctttagcagca
ataggacagtgtcgccttataagtctatgggatagcttgttcgctcacttgcaacaacct
gttgcacaaattttactcacaagaaatgatatcgcagatcgaacccaataccgaaatgct
cagaatacgttacacgagcttctagaaatgggcgtcatccctatcgttaacgagaacgat
actctagctgtagctgaaatcaaatttggagacaatgatactctatctgcaatcactgca
gctatgctccatgcagattacttgttcctgatgactgatgtcgattgtctctatgataaa
aatcctcgaacgcatccagatgcacaagcaattgaggtcgttgaagacatctccgcatta
caggccgatgtatcaagtgccggctctagcctcggtacaggaggaatgtccacaaaaata
gttgctgcccgtctcgccacctccgcaggtgtaacaactgtcataacacggtcctctagc
ccagggaacattgcaagtattgtaagctatgttcaatccctcaaacattctacttcaggc
ggcaaaaccggtgatgttgtttcgcaatcgcagacaccggaaactattacaagatccaat
tccacactgtcccttactggtgtagcatcatcacccgtggagccgcctctgcatacccgg
tttcttccatcgcatcaaccgatccgggaccgctatttctggcttctacatggcctctct
ccacatggaacgatttatattgatgctggcgctcatcgagcattggcggccaaagctggt
ctgcttcctgccgggatcgtagatgtggagggcagctttgcccaacaagaagctgtgcgt
ctagtagttgttgaccgtccaagctcgccagatacaaagattgtatcagggtctggagtt
gaagtgggtagggcgctagtgaactacagtgcaatggagataactaggattaaaggtatg
agaagtagtgaaatacacggattattgggctatgcagatagtgagatttaa

DBGET integrated database retrieval system