KEGG   Botryotinia fuckeliana: BC1G_15830Help
Entry
BC1G_15830        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
bfu  Botryotinia fuckeliana
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:bfu00350]
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:bfu00740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 360 aa AA seqDB search
MYDTPLIATEFAKKDSLTLTTASDKKEEQKFMKSDLSGQDRIAYTNAVLCLQSKEPITPS
EVVPGVRSRFDDFVAAHINQSFTIHGTGNFLGWHRYYVHTYEKALREECGYKGYQPYWNW
GRYADDPIHSPLFDGSPTSMSGNGLYYNHTGVPINLAPAPFDIIPPGVGGGCVTTGPFKN
MTVHLGPVFGTISGTPVNPQADGFGYNPRCLRRDVNVHSAAVTKTNYTYDLITKPSNADI
YWFQTVMQGLFSIGEWGVHTGGHYTVGGDPGGDFFTSSGDPAFYLHHGMIDRVWWIWQLQ
DLAKRQDAVSGTMTLNNVPPSRNTTLEDLQDIGYNAGPVPLQDLMNTLGGLNGELCYIYV
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtacgacacaccgcttatcgcaactgaatttgccaagaaagacagtcttacactcaca
accgcgtcagacaagaaagaagaacagaaatttatgaagagcgatctctcagggcaggat
cgaatcgcatacacaaatgccgtgctttgtttacagtccaaagaacctatcacgccttct
gaagttgtgccgggtgttcgaagtcgctttgatgacttcgttgccgcgcatataaatcag
agctttaccattcatggtacaggcaattttctgggctggcatagatattacgttcataca
tacgaaaaagcactccgcgaagaatgtggatacaaaggatatcaaccttattggaactgg
ggcagatacgccgacgacccgatacactccccgctctttgacggaagtcctactagcatg
agcggcaatggcttgtattacaatcatactggtgtccctatcaacctcgcgccggcacca
ttcgacattatcccgcctggtgttggtggtggatgtgttaccacaggtccgtttaagaat
atgactgtccaccttggcccagtcttcgggacaatatccggcacaccagtgaaccctcaa
gccgacggcttcggttacaatccacgatgcctccgccgcgatgtcaatgttcacagtgcc
gctgttacgaaaaccaactatacttacgacctcataacaaaaccttcaaatgcagatata
tattggttccagactgtgatgcaaggcttgttcagcataggagaatggggcgttcatacc
ggagggcattatacagtgggcggagatccgggcggtgacttctttacatcttccggcgac
ccggctttctatcttcatcacggcatgatagatcgggtttggtggatatggcaacttcag
gatttggcaaagagacaggatgccgtctcgggaacgatgactttgaacaacgtccctcct
agtagaaacaccaccttggaggatctacaggatattggatataatgcgggtcctgtgcca
ttgcaagatctgatgaacacactaggagggctgaatggagaactgtgctacatctatgtg
tga

DBGET integrated database retrieval system