KEGG   Botrytis cinerea: BC1G_15996Help
Entry
BC1G_15996        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
bfu  Botrytis cinerea
Brite
Enzymes [BR:bfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     BC1G_15996
Protein kinases [BR:bfu01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   BC1G_15996
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 213 aa AA seqDB search
MPSIKRVKDWYAQSFEEITTLPRPQLSSDVKERLMKPAKINGKPSKILAEATQNPSVMRG
QYSSNAHGKKESKSAAARRYFATVEDSTDWPPELHDYNQRFAQTLNHIKRRHDGVVTTVA
QGILEYKRKRQRMQIDNNIQSFLDRFYMSRIGIRMLIGQHIALTDQSHDKDPNYVGIICT
KTNVRDLAEEAIENARFVCEDHYGLFDAPKIQL
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgccctcgatcaagagggtgaaggattggtatgcacagtcatttgaggaaatcaccaca
ctccctcgaccacaattatcatcagatgttaaagaaagacttatgaagcccgcgaaaatt
aatgggaagccatccaagatacttgcagaagcaacacaaaacccgagcgtaatgaggggg
caatacagctccaatgcacatggaaaaaaagaatcaaagtcggcagcagcaagaagatat
tttgccacagtagaagatagtacggactggccccccgaacttcacgattataaccaaaga
ttcgcacaaacccttaatcatataaagaggcggcacgacggagttgtcacaaccgtcgcg
caaggaatactcgaatataagcggaaacggcaacgcatgcagatcgataataatatccaa
tccttcctcgaccgtttctacatgtcccgtatcggcataagaatgctcattggacaacac
atagcactcacagatcaaagtcacgacaaagatcctaattatgtaggtattatatgtacg
aaaaccaatgttcgagatcttgcggaagaagcaatcgaaaacgctagatttgtctgcgaa
gaccattacggactttttgatgcgccaaagattcaactc

DBGET integrated database retrieval system