KEGG   Botrytis cinerea: BC1G_16069Help
Entry
BC1G_16069        CDS       T01072                                 

Definition
similar to NADH-cytochrome b5 reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
bfu  Botrytis cinerea
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BC1G_16069
Enzymes [BR:bfu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     BC1G_16069
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 313 aa AA seqDB search
MSTAPANKFLSKAYVDGIYIPSGLLILGCFIVKKDWLPFAVALAAVLGGYKIWSSQETPV
LKPTVFQDFELKEKTVISHNVAIYRFSLPKPTSILGLPIGQHISISAVLPQPDGSNKEIV
RSYTPVSGDHQPGYFDLLIKSYPTGNISKHMASLTVGQTIKVRGPKGAMVYTPNMVRHFG
MIAGGTGITPMLQVIRAVIRGRAAGDKTEVDLIFANVNPEDILLKDDLDSLAAQDKGFRV
HYVLNNPPEKWDGGVGFVTPEMITKWLPKPAEDVKLLLCGPPPMISAMKKASEGLGFKKA
KPVSKLEDQVFAF
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagtacagcaccagcaaataagttcttgtcaaaggcatacgttgatggcatctatatt
ccgtctggccttttgatacttggatgttttattgtcaaaaaagattggcttccgttcgcc
gttgctcttgctgccgtgctcgggggatacaagatttggtcaagccaagaaaccccagtt
ctcaagccaactgtcttccaagattttgagctcaaggagaagactgtcatctctcacaat
gtagcaatttatcgattcagtctgccaaaacctacctctatcctcggtcttcctatcggt
cagcacatctccatttccgctgttcttccccaacccgatgggtcaaacaaggaaatcgtt
cgatcttatacacctgtctctggcgatcaccaaccaggctacttcgacctcctcatcaag
tcctaccccaccggaaatatctctaaacatatggcttccctcactgttggtcaaactatc
aaggtccggggtccaaaaggtgcaatggtctatactcccaacatggttcgtcattttggt
atgatcgctggtggaaccggtattacacccatgttacaggtcattcgtgctgtcattaga
ggcagagctgctggagataagactgaggtcgatttaattttcgcaaatgttaatcctgag
gatatcttgttgaaagatgacttggatagtttggctgctcaggacaagggtttccgtgtt
cactacgttttgaacaacccacccgagaaatgggacggcggtgttggttttgtcactcct
gaaatgatcactaaatggcttcctaagccagcagaagatgttaaacttttgctctgtgga
ccaccacccatgatcagtgctatgaagaaagcctctgaaggtttgggcttcaaaaaggca
aagccagtcagcaaattggaagatcaagtcttcgccttctag

DBGET integrated database retrieval system