KEGG   Botryotinia fuckeliana: BC1G_16069Help
Entry
BC1G_16069        CDS       T01072                                 

Definition
similar to NADH-cytochrome b5 reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
bfu  Botryotinia fuckeliana
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bfu00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 313 aa AA seqDB search
MSTAPANKFLSKAYVDGIYIPSGLLILGCFIVKKDWLPFAVALAAVLGGYKIWSSQETPV
LKPTVFQDFELKEKTVISHNVAIYRFSLPKPTSILGLPIGQHISISAVLPQPDGSNKEIV
RSYTPVSGDHQPGYFDLLIKSYPTGNISKHMASLTVGQTIKVRGPKGAMVYTPNMVRHFG
MIAGGTGITPMLQVIRAVIRGRAAGDKTEVDLIFANVNPEDILLKDDLDSLAAQDKGFRV
HYVLNNPPEKWDGGVGFVTPEMITKWLPKPAEDVKLLLCGPPPMISAMKKASEGLGFKKA
KPVSKLEDQVFAF
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagtacagcaccagcaaataagttcttgtcaaaggcatacgttgatggcatctatatt
ccgtctggccttttgatacttggatgttttattgtcaaaaaagattggcttccgttcgcc
gttgctcttgctgccgtgctcgggggatacaagatttggtcaagccaagaaaccccagtt
ctcaagccaactgtcttccaagattttgagctcaaggagaagactgtcatctctcacaat
gtagcaatttatcgattcagtctgccaaaacctacctctatcctcggtcttcctatcggt
cagcacatctccatttccgctgttcttccccaacccgatgggtcaaacaaggaaatcgtt
cgatcttatacacctgtctctggcgatcaccaaccaggctacttcgacctcctcatcaag
tcctaccccaccggaaatatctctaaacatatggcttccctcactgttggtcaaactatc
aaggtccggggtccaaaaggtgcaatggtctatactcccaacatggttcgtcattttggt
atgatcgctggtggaaccggtattacacccatgttacaggtcattcgtgctgtcattaga
ggcagagctgctggagataagactgaggtcgatttaattttcgcaaatgttaatcctgag
gatatcttgttgaaagatgacttggatagtttggctgctcaggacaagggtttccgtgtt
cactacgttttgaacaacccacccgagaaatgggacggcggtgttggttttgtcactcct
gaaatgatcactaaatggcttcctaagccagcagaagatgttaaacttttgctctgtgga
ccaccacccatgatcagtgctatgaagaaagcctctgaaggtttgggcttcaaaaaggca
aagccagtcagcaaattggaagatcaagtcttcgccttctag

DBGET integrated database retrieval system