KEGG   Botrytis cinerea: BC1G_16097Help
Entry
BC1G_16097        CDS       T01072                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
bfu  Botrytis cinerea
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:bfu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    BC1G_16097
Exosome [BR:bfu04147]
 Exosomal proteins
  Proteins found in most exosomes
   BC1G_16097
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1665 aa AA seqDB search
MAPLPIKFTELLQLTSVGVEAQSIGFNSCTLESDSYICVREKKNEAAQPEVVIVDLKQNN
AVTRRPIKADSAIMHWSKQVIALKAQSRTLQIFDLGAKAKLKSATMNEDVVFWKWFSETS
LGLVTDTTVYHWDVFDPNQASPVEVFKRNPNLAGCQIINYRVSGDGKWMVVVGITQQQGR
VVGAMQLYSKDRGISQAIEGHAAAFGTLRLESAPADTKVFTFSVRTATGAKLHIVEVDHQ
ASNPTFSKKAVDVYFPAEAVNDFPVAMQVSQKYSIIYLVTKYGFIHLYDLETGTCIFMNR
ISSETIFITAGDSESAGLVGVNRRGQVLSVSVDETTVIPYLLQNPANSGLAVKLASRAGL
PGADNLYANQFEQLLAAGNYSEASKIAANSPRGFLRTPQTIERLKNVPAVPGQLSVILQY
FGVLLDKGSLNKHETLELVRPVLAQNRKHLLEKWMKENKLDCSEELGDIVRQQDTQLALA
IYLKANVPHKVVAAFAESGQFEKILPYAQQAGYQPDYVQLLRNIISINPEKGAEFATQLA
NTEGGSLVDIERVVDVFQSQGMVQPATGFLLDALKENNPEQGHLQTRLLEMNLMNAPQVA
DAILGNEMFSHYDKPRIAQLCEQAGLAQRALEHYEDPEAIKRVIVNIVASPTFSQEWLTG
YFGRLSLEQSLDCLDAMLKVNIRQNLAAVVQIAVKYSDLLGAVRLIDLFEKYKTAEGLYH
YLGSIVNLSEDQNVVFKYIESAAKMQQFNEVERICRDSNFYNPERVKNFLKEAKLAEQLP
LIIVCDRFNFIHELVLYLYQNQQFQSIEVYVQRVNPARTPAVVGGLLDVDCDEQIIKNLL
NSVNHASIPIDELVHEVETRNRLKLLLPFLEATLAAGNQQQAVYNALAKIYIDSNNNPEK
FLKENSQYDTLVVGKGQNDLELVNVTNENSMYKAQARYLLERADRELWEFVLSENNIHRR
SVIDQIISTAVPESTEPEKVSVAVAAFLGADLPGELIELLEKIVLEPSPFSDNESLQNLL
ILTATKADKGRVMDYIHKLDAFNPADVASICIEVGLYEEAFEVYKKINDHINAANVLVEH
IVSIDRANDYAEKVELPEVWSRVAKAQLDGLRVSDGIASYIRADDPSNYLEVIEIATHAG
KDEDLIKYLRMARKTLREPAIDTALAFAYARTDQLSELEDFLRGTNVADIEESGDKAYAE
GFHQAAKIFFTSISNWAKLATTLVHLEEYQSAVECARKANNIKVWKQVNAACVEKKEFRL
AQICGLNLIIDAEELQNLVKQYERNGYFDELIAVLEQGLGLERSHMGMFTELGIALSKYH
PDRTMEHLKLFWSRINIPKVIRACEEAHLWPELIFLYCHYDEWDNAALAMMERAADAWEH
HSFKDIVVKVANLEIYYRALNFYLQEQPSLITDLLQALSPRIDVNRVVKMFEKSDNIPLI
KPFLLNVQTQNKKIVNSAIHDLLIEEEDYKTLRDSVENYDNYDAVELAQRLERHDLVFFR
QIASNIYRKNKRWEKSIALSKQDKLFKDAIETAAISSKEDVVEELLRYFVDIGSRECYVG
MLYACYDLIPVHVVMEISWRHGLTDFTMPFMINYLAQQSSTIAELKKDNEERKLKEKSQV
QEEDNTPILGGNRLMITAGPTGRASPAQFGQTNGFAPQPTGFGGF
NT seq 4998 nt NT seq  +upstreamnt  +downstreamnt
atggctccattaccaatcaagtttacggagcttctccagttaacaagtgtcggagttgag
gcacaatcgataggttttaattcatgtacactggagtcagattcctacatctgcgtacga
gaaaagaagaacgaagctgcacaaccagaagtcgttatcgtcgatctaaagcaaaataat
gctgtcactcgaagacctattaaggcggatagtgccattatgcattggtcgaaacaggtc
atcgcattaaaggcacaatcaaggaccttgcagatatttgacttgggcgccaaggcaaag
ctgaagtctgctaccatgaatgaagatgttgttttctggaaatggttcagtgagacaagc
ttgggattagttaccgatacaaccgtttaccactgggatgtatttgacccaaaccaagca
tccccggtagaggtgttcaagagaaatccaaaccttgctgggtgccaaattatcaactat
cgtgttagcggcgacggaaagtggatggtagtcgtaggcatcacacaacaacaaggacga
gtggtgggagcgatgcaactttattcgaaagacagaggcatcagtcaggctatcgaaggc
cacgcggcagcgttcggtacattacgattggaatcagccccagcagatacgaaggtattc
acattttcggttcggactgctactggcgcaaagctacacatagtcgaggtcgaccaccaa
gcttcaaacccaacattttcgaagaaggcagtcgatgtatacttccctgccgaagctgta
aacgatttcccagttgcaatgcaagtttcacaaaaatacagcattatttacttggttacc
aaatacggctttattcacctttacgatcttgagactggtacatgtattttcatgaaccgt
atctcgagcgagaccattttcatcacagctggcgattcggaatctgcaggacttgttggt
gttaaccgaagaggacaagtattgtcggtatctgttgatgaaacgacagttattccatac
ctcctccaaaatcctgcaaactccggtttagccgtcaagcttgcttcaagagctggtcta
cctggtgcggacaatctctatgccaatcaatttgagcaacttttggctgcaggaaactac
tccgaggcatcgaagattgctgcaaactctcctcgcggcttcttgcgaacaccacaaacc
atcgaacgtcttaagaacgtaccggctgtaccaggtcaactatctgtcatcttgcaatac
tttggtgtattgcttgacaagggatcgttgaataaacacgagaccttagagcttgtgcga
cctgtcttggcccagaaccgaaagcatctccttgaaaagtggatgaaggagaacaagctt
gactgttctgaagaattaggtgacattgtccgtcaacaagatacacagcttgcacttgct
atctatctcaaggcaaacgttcctcacaaagtagttgctgctttcgcagagagtggccaa
tttgagaagatcttaccctacgcccaacaagcaggttatcagccagattatgtccaatta
cttcgcaacatcatctccatcaaccctgaaaagggagctgagttcgctacacaattggca
aacacggagggtggttcgcttgtcgatattgagcgagttgtagacgtattccagtctcaa
ggaatggttcaacctgctacgggattcttgcttgatgcattgaaggagaataatccagag
caaggacacttacagactcgtcttcttgaaatgaatctcatgaacgctcctcaagttgcc
gatgccattcttggtaatgagatgttctcacactatgataagcctagaatcgcacagttg
tgtgaacaagctggccttgctcaaagagctttggagcattatgaagaccctgaagccatc
aaacgcgtgatcgtcaatattgttgcttcaccaactttcagtcaagaatggctcactggt
tactttggtcgcttgtcccttgagcagtcgttagactgtcttgatgctatgctcaaggta
aacattcgtcaaaaccttgcggctgttgttcaaatcgctgtcaaatactccgatttactc
ggtgctgtcagattgattgacctattcgaaaagtacaagactgccgagggtctctaccat
tatcttggtagcattgtcaacttgagtgaagatcaaaacgtcgtgttcaaatatattgag
agcgccgccaagatgcagcaatttaacgaggtggaacgcatttgcagagattccaatttc
tacaaccctgaacgcgtgaagaacttcttgaaggaagccaaattggccgagcaattgcca
ctcatcatcgtctgtgatcgattcaacttcattcacgagttggtactttacctctatcaa
aatcaacaatttcaatctatcgaggtctatgttcagcgtgtgaacccagcccgaacacct
gctgttgttggtggtttacttgatgttgactgtgatgagcaaattatcaagaaccttttg
aactccgttaatcatgcttccatccctatcgatgaacttgttcatgaggttgaaacaaga
aaccgtcttaagcttctgttgccattccttgaggcaaccttggctgcaggcaaccagcaa
caagctgtatacaatgctttagcaaagatatacatcgacagtaacaataaccccgaaaag
ttccttaaagaaaattctcaatatgacaccttggtcgtcggcaaaggtcaaaacgacctt
gagcttgtcaacgtcaccaatgagaactccatgtacaaggctcaagctcgctatctcttg
gagagagctgatcgagagctttgggagtttgttctctcggagaataatatacatcgccga
tccgtcattgatcaaatcatctctacagctgttcccgagtcaactgaacccgaaaaggtc
tctgtcgcagtcgcagctttcctaggtgctgatcttccaggagaattaattgaattactg
gaaaaaatcgttctcgagccttcgccattcagtgacaatgagagcttacaaaatctcctc
attcttaccgctaccaaagctgataagggtcgagtcatggattatatccacaaattggat
gcattcaacccggcggatgtagcttctatctgtattgaagttggcttgtatgaagaagca
ttcgaagtttacaagaagattaacgaccacatcaacgctgcaaatgtgctcgttgagcac
attgtcagtatcgatcgcgcgaacgactatgctgagaaagtggagcttcccgaagtatgg
agtagggttgccaaggctcaattggatggtctacgtgtaagcgatggtattgcctcatat
attcgcgccgatgatcccagcaattatctcgaagtcattgaaattgcaactcatgctgga
aaggacgaggaccttatcaaataccttcgtatggctcgcaagactcttcgtgagcctgcc
attgatactgcacttgcttttgcatatgctcgtaccgatcaactcagcgaactcgaggac
ttcctcagaggaaccaatgtcgctgatatcgaagaatcaggtgacaaggcatatgctgaa
ggcttccaccaagccgcgaagattttcttcactagtatttcaaactgggccaaacttgcc
accaccctcgttcatctagaggaataccagtctgctgttgaatgtgcccgaaaggccaac
aacatcaaggtctggaagcaagttaacgctgcttgtgttgagaagaaggaattccgcctt
gcccagatttgtggtctcaatttgattattgatgctgaagagttgcagaacttagtcaag
caatacgaacgcaatggttatttcgatgagcttattgcggtgcttgagcaaggtctaggt
ttagagagaagtcacatgggaatgtttactgaattaggcattgccctttccaaatatcac
ccagaccgcacaatggagcacttgaagctcttctggagcagaatcaatattcccaaggtg
attcgtgcctgcgaggaagctcacctttggcccgagttgattttcttgtactgccattat
gacgagtgggacaatgccgctcttgcgatgatggagagagctgccgacgcatgggagcat
cactcattcaaggatatcgttgtcaaggtagcaaatttggagatctactaccgcgctcta
aacttctatcttcaagagcaaccatctctcattaccgatcttcttcaagcactttcacca
agaatcgacgtcaatcgtgttgtgaagatgttcgaaaaatctgacaacatccctctcatc
aaacccttccttctcaacgttcagacccagaacaagaagattgtcaacagtgccatccat
gacttgttgattgaagaggaagattataagaccctccgtgattcagtcgagaactatgat
aactatgatgccgtcgagcttgctcaacgattagagcgtcacgatctagtcttcttccgt
caaattgcttccaacatctaccgcaagaacaagcgctgggagaaatctattgctctttca
aaacaagataagcttttcaaagatgcaattgagactgccgctatttctagcaaggaagat
gtcgttgaggagttgcttagatatttcgttgatattggtagccgtgaatgttatgttggc
atgctctatgcttgctacgacctcattcctgtccatgttgttatggaaatttcatggcgt
catggtcttaccgattttactatgccattcatgatcaactacttggcccagcaaagttcc
acaatcgctgagttgaagaaggacaatgaagagagaaagttgaaagagaagtcacaagtt
caggaagaggacaacaccccaatcctcggaggtaatcgtctaatgatcaccgctggacct
accggacgtgcatctccagcccagttcggccaaactaatggattcgcaccacagccaaca
ggttttgggggattttag

DBGET integrated database retrieval system