KEGG   Borrelia garinii PBi: BG0002Help
Entry
BG0002            CDS       T00194                                 

Definition
beta-N-acetylhexosaminidase, putative
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bga  Borrelia garinii PBi
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bga00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BG0002
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BG0002
Enzymes [BR:bga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BG0002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(629..1648)
Genome map
AA seq 339 aa AA seqDB search
MGFLKALSFIFFCLNLFAIESLPEIDYEYFNKDKSDLVDLIRFLGEFDFQTILKDRRLFI
GIRNLTNFKNVQGLNADDINRIKKINPIGIILFRENLKDAEQTKGLISAIKSHIGHDIFI
AIDEEGGIVSRASENKKMGVYNFPAMEYVGNVKDLHLIYKIGEVLAKQLRRLGINLNMAP
VADIKFIPHTPLLNRTFGGYSAYNIGLMVEAFIDGMQNHGVFSAIKHFPGLGGITTDTHK
YLAFLPYSKSFLMLNNFVPFVFGKTSKFIMIGHANVPKISKDITSMSKSIVNIIRENLNI
TSIMITDSYNMGAITRSFSNIENAIKKSLSSGINIVLIP
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgggctttttaaaagctttatcttttatctttttttgtttaaatttatttgcgatagaa
tctttgccagaaatagattatgaatattttaataaggataaatcagatcttgtagattta
attaggtttttaggtgaatttgattttcaaactattttaaaagatagaagattatttatt
ggaattagaaatttaacaaattttaaaaatgttcaaggacttaatgccgatgatattaat
agaataaaaaagattaatccgattggtataattttatttagagaaaatttaaaagatgct
gagcaaacaaaaggattgattagcgcaataaaaagtcatattggacatgatatttttatt
gctattgatgaagagggagggatagttagtagagctagtgaaaataaaaaaatgggagtt
tataattttccggctatggagtatgtagggaatgtcaaagatttgcatcttatttataaa
attggtgaagttcttgctaaacaattgcgtaggttgggtattaatttaaatatggctcca
gttgccgacataaaatttataccacatacccctttactaaatagaacatttgggggatat
tctgcttataatattgggcttatggtagaagcttttattgatggcatgcagaatcatgga
gtattttcggcaattaagcattttccaggattagggggaataaccacagatacacataaa
tatttggcttttttaccttatagtaaaagctttttaatgttaaataattttgtgccgttt
gtttttggcaagacttctaaatttatcatgattggccatgcaaatgttcctaaaatttct
aaagatataactagcatgtctaaaagtattgttaatattataagagaaaatttaaatatt
actagtattatgataacagattcttataatatgggagcaattacaagaagtttttctaat
attgaaaatgctattaaaaagtctttaagttcaggtataaatatagttcttattccttag

DBGET integrated database retrieval system