KEGG   Borreliella bavariensis PBi: BG0023Help
Entry
BG0023            CDS       T00194                                 

Gene name
ruvA
Definition
(GenBank) Holliday junction DNA helicase
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bga  Borreliella bavariensis PBi
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bga00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BG0023 (ruvA)
Enzymes [BR:bga01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BG0023 (ruvA)
DNA repair and recombination proteins [BR:bga03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BG0023 (ruvA)
    RecFOR pathway proteins
     BG0023 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(22008..22598)
Genome map
AA seq 196 aa AA seqDB search
MINKIHGKVIEKKESSLVLMTTVFEFELLVSAFCLANFKLSDKVELFTYLYARENELKLF
GFLNSDERETFKSLIGVSGIGPRAALRVLSNIRYNDFKEAIDREDVELVSKIKGIGKKMA
GKMFLHLQGKLLINNELESSLFGFKELEESIVSMGFDRKIVNSKLKEACDLIEFSNLKDS
EKEQFLFKEVLKRMSN
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgataaataagattcatggtaaagttatagaaaaaaaagaatctagtttggttttaatg
actactgtttttgaatttgagcttttagttagtgcattttgccttgctaattttaagttg
tcagacaaagttgaactttttacttatctttatgctagagaaaatgaattaaagcttttt
gggtttctaaattcagatgaaagagagacttttaaaagtcttattggagtaagcggaata
gggccaagggctgctttaagagtgctctctaatataaggtataatgactttaaggaggct
attgatagagaggatgttgagcttgtttctaaaatcaaaggtattggcaaaaaaatggct
ggtaaaatgtttttacatcttcagggtaagcttttgattaataatgagcttgaatctagt
ctttttggatttaaagaattagaagaatcgattgttagcatgggttttgacagaaaaatt
gtaaatagtaagcttaaggaggcttgcgatctaatcgaattttcaaatttaaaagactct
gaaaaggagcagtttttatttaaggaggttttaaaaagaatgtcgaattaa

DBGET integrated database retrieval system