KEGG   Borrelia garinii PBi: BG0209Help
Entry
BG0209            CDS       T00194                                 

Gene name
gtaB
Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bga  Borrelia garinii PBi
Pathway
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bga00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BG0209 (gtaB)
   00052 Galactose metabolism
    BG0209 (gtaB)
   00500 Starch and sucrose metabolism
    BG0209 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    BG0209 (gtaB)
Enzymes [BR:bga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BG0209 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
208304..209140
Genome map
AA seq 278 aa AA seqDB search
MKGIILAAGYGTRFLPITKTIPKEMLPILNKPAIDYIIQEFIDSGIKDILLISSRRKKVL
EDYFDREIELENIFLKENKKNELEKIKNKKINISFIRQKEMLGTGNALLYAKPWINREPV
IVAYPDDLHIGNPALSLQLIKLYEKTGKNIISIIENPENINRYGVIDLYEDKIHVKNIVE
KPKIGSEPSNKASIGRFLYNYEFFEHLEEGFKLHQKGEYYHIYALKKLMDQKKVLYKNIK
GKRIDIGTLEGYLDAIINFAKKNKNLMEIIKKGINEND
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcattattctagcagctgggtatggaacaagatttttaccaataacaaaaaca
attccaaaagaaatgttgccaattttaaacaagccggccatagattatattatccaagaa
tttatcgattcaggaataaaagacattttattaataagctcaagacgaaaaaaagttctt
gaagattattttgatagagaaattgaacttgaaaatatttttttaaaagaaaataaaaaa
aatgaattagaaaaaatcaaaaacaaaaaaattaacataagcttcataagacaaaaagaa
atgctgggcacaggaaatgctctgctttatgcaaaaccctggataaatagagagcctgta
attgtagcttaccctgacgatcttcacattggaaatccagcattaagcttacaattaatc
aaactttatgaaaaaactggaaagaacataatatctattattgaaaatccagaaaatata
aacagatacggagtaatagatctatatgaagataaaatccatgtaaaaaacattgttgaa
aaaccaaaaattggaagtgagcctagcaataaagcatctattggaagatttttgtataac
tatgagttttttgaacatttagaagaaggatttaaactgcatcaaaagggtgaatactat
cacatttatgctttaaaaaaacttatggatcaaaaaaaagtattatataaaaatattaag
gggaaaagaattgatataggaactcttgagggctatttagacgcaataataaattttgca
aaaaaaaataaaaatttaatggaaattataaaaaaaggaataaatgaaaacgattaa

DBGET integrated database retrieval system