KEGG   Borrelia garinii PBi: BG0242Help
Entry
BG0242            CDS       T00194                                 

Gene name
dck
Definition
deoxyguanosine/deoxyadenosine kinase(I) subunit 2
Orthology
K00893  
deoxycitidine kinase [EC:2.7.1.74]
Organism
bga  Borrelia garinii PBi
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bga00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bga00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(243717..244319)
Genome map
AA seq 200 aa AA seqDB search
MIVIEGLIGVGKTTLGNILSNELKVPFYSELNNDFTLAVLDKFYRDKSRWAFPVQINFLN
ERFKLIKGVFRTKGGILDRSIYGDCVFASLLNCDGHISDEEYKIYIDLLDNMLEHSQRPS
LLIYLDCSIDEVERRIKNRNRSFEMNIPRDYLEGLNRKYLKWYNEYSLSSKIKFSYDDIN
IFNEEDKNKVISLIRDKLVL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
gtgattgtaatagaaggtttaattggggtaggaaaaactactcttggaaatattttatca
aatgaattaaaagttcctttttacagtgaacttaataatgattttactttggctgtatta
gataaattttatagggataaatccagatgggcattcccagttcaaattaattttcttaat
gagaggtttaagctaataaaaggtgtgtttagaacaaaagggggcatacttgacagatct
atttatggtgattgtgtgtttgcgtctcttttaaattgcgatgggcatatttctgatgag
gaatataaaatatatattgatcttcttgataatatgcttgaacattctcagcgtccaagt
ttacttatttatcttgattgtagtattgatgaggttgagcgtaggattaaaaatagaaat
agaagctttgaaatgaatattcctagagattatcttgagggccttaataggaaatatttg
aagtggtataatgaatacagcttgtcttcaaagataaaattttcttacgatgatataaat
atttttaacgaagaagataagaataaagtgatttctttaattagagataaacttgtatta
taa

DBGET integrated database retrieval system