KEGG   Borrelia garinii PBi: BG0244Help
Entry
BG0244            CDS       T00194                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bga  Borrelia garinii PBi
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bga00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
245534..247039
Genome map
AA seq 501 aa AA seqDB search
MKYILSIDQGTTSSRAIVFDKHANIKGLAQKEFTQIYPQPSWVEHDPTEIWGSQLGVITE
ALANSRILPNEVDAIGITNQRETTVIWEKSTGKPIYNAIVWQDRRTAKICDQLTKEGKDK
IILEKTGLVLDSYFSGTKILWILDNVEGARQKAENGELCFGTIDTWLLWNLTQKKVHATD
YSNASRTLLLNIKTLEWDDELLKILNIPKAILPELKESSTIYGETDKSIFGAEIPIAGIA
GDQFAATFGQACLKKGMAKNTYGTGCFLTVNIGKEPIINHERLLTSIAWGRKKTVTYVLE
GSVFIGGAVIQWLRDGLEFFRKSSDAESLASSASDNGGVYFVPAFVGLGAPHWDSYARGT
IIGITRGSTKAHITRAALESIAFQSFDILNTMKKSIPNFEIKELRVDGGASQNNLLMQFQ
ADLLECKVVRPKITETTALGAAYLAGLASGYWQSAEEIISLWQVDKIFEPSMPKNQKEKL
LENWNRAIERSKSWIQNSNSL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatattttatctattgatcaaggtactactagctcaagagcaatagtatttgat
aaacatgcaaacataaaagggcttgctcaaaaagaatttactcaaatttatccacaacca
agctgggtggagcatgatcctactgaaatatggggatcgcaacttggagttataacagaa
gctcttgcaaattcaagaattttaccaaatgaagttgatgctattggaataactaatcaa
agagaaactacagttatatgggaaaaaagtacaggaaaacccatttataatgcaatagta
tggcaagatagaagaactgcaaaaatttgtgaccaattaacaaaagagggaaaagataaa
attattttggaaaaaacaggtttagtactagattcttattttagtggtacaaaaatactg
tggatcttggataatgtagagggcgctagacaaaaagctgaaaatggtgaattgtgtttt
ggaacaatagatacatggctattatggaatctgactcaaaaaaaagtacatgcaaccgac
tattctaatgcttcaagaacattattgttaaacattaaaacattagaatgggatgatgaa
cttttaaagatattaaatattccaaaagcaattttgcctgaacttaaagaaagctctaca
atatatggcgaaacagacaaatcgatatttggagcagaaattcctattgcaggaattgcc
ggagatcaatttgcagcaacatttggacaagcctgccttaaaaaaggtatggctaaaaac
acatatggaactggttgctttttaacggtaaatataggtaaagaaccaattattaaccat
gaaagacttttaacttcaatcgcctggggaagaaaaaaaaccgtaacttatgttcttgaa
ggaagcgtttttattggtggagccgtaatccaatggctaagagacggtcttgaatttttc
agaaaaagttcagatgcagaatcattggcaagctctgcttcagataatggaggggtttat
tttgtaccagcatttgttgggctcggtgcacctcattgggattcttatgcaagaggaaca
atcattggaataacaaggggatcgacaaaagcgcacattacaagagctgctcttgaaagc
atcgcatttcaaagttttgatatactaaatactatgaaaaaatccattcccaactttgaa
attaaagaattaagagtagacggaggagcaagtcaaaacaatctattaatgcaatttcaa
gctgatcttttagaatgtaaagttgtaagaccaaaaataacagaaacaacagcacttggg
gctgcttatcttgcaggacttgcatcgggttattggcaaagcgccgaggaaatcataagc
ctttggcaagtagataaaatatttgaaccttcaatgccaaaaaatcaaaaagaaaagctt
cttgaaaattggaacagagcaattgaaagatcaaaatcctggatacagaattccaatagt
ctataa

DBGET integrated database retrieval system