KEGG   Borrelia garinii PBi: BG0418Help
Entry
BG0418            CDS       T00194                                 

Gene name
cheB-1
Definition
protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bga  Borrelia garinii PBi
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bga02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:bga02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
426207..427334
Genome map
AA seq 375 aa AA seqDB search
METKISVLIIEYFAVKRKLISDLINSSPKLQVIATASNGKFATNKLKKHNPEVILMNLEE
NNIKDILFLEKKNNINKTIPIIVTSSNQNLINIAALKGADDLILVSKNKKSHEIKKEQII
NSLLAYGSISIKNKIVCNKDMKIKNYEGARIFLNHKNDIFSLNKLEEHTKEKILNEKEIK
KLKLRKFDIIAIGISAGGPVALKSILPEIPESFPPIIIVQHMPKGFTEEFAKNLNNLCKI
RVKETANKEILKQGHAYISSGGYHTKIQKIDGNYKIQIFDGKHINGHKPSIGVLFQSIAE
IAKDKAIALIMTGMGNDGSREIGDIKKAGGLTIAQDKESSMVFGMPKIAIKENNIDYIVP
LNHMVKLLKAILIDS
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtggaaacaaaaatttctgtacttatcatagaatactttgctgtaaagagaaagcttata
tcagaccttattaattcgtctcccaaactccaagtcattgcaactgcttctaatggcaaa
tttgcaaccaataagcttaaaaaacataaccccgaagtaatactaatgaatttagaagaa
aataacattaaagatattctctttttggagaaaaaaaataatataaacaaaacaatacca
attatagtcacatcttcaaatcaaaacctaataaatattgctgctttaaagggcgctgat
gatcttatactagtatctaaaaataaaaaatcacatgaaatcaaaaaagaacaaattatt
aattctcttttggcctatggatcaatatctataaaaaacaaaattgtttgcaataaggat
atgaaaataaaaaactatgagggagctagaatttttttaaatcacaaaaatgacattttt
tcattaaataaacttgaagaacatacaaaagaaaaaatattaaatgaaaaagaaataaaa
aaacttaaacttagaaaattcgacataatagcaattggaatatcagcggggggtcctgtg
gccttaaaatcaatattaccagaaatacctgaaagcttccccccaataataattgttcaa
catatgcctaaaggatttacagaagaatttgcaaaaaatcttaataatctttgcaaaata
agggtaaaagaaaccgccaataaagaaatattaaagcaaggacatgcatacataagctca
ggtggatatcatacaaaaattcaaaaaatcgatggcaactataaaatacaaatcttcgac
ggcaaacatataaatggccacaaaccatctattggggtattatttcaatctattgcagaa
attgcaaaagataaagcaattgccctaataatgactggaatgggaaatgatggatcaaga
gaaattggtgatataaaaaaagctgggggactaactattgcgcaagataaagaaagttcc
atggtttttggaatgcccaaaatagcaataaaagaaaacaatatagactatatagttcca
ctaaaccatatggtaaaattattaaaagctatactaattgatagctaa

DBGET integrated database retrieval system