KEGG   Borrelia garinii PBi: BG0657Help
Entry
BG0657            CDS       T00194                                 

Definition
nicotinate phosphoribosyltransferase (EC:2.4.2.11)
Orthology
K00763  
nicotinate phosphoribosyltransferase [EC:6.3.4.21]
Organism
bga  Borrelia garinii PBi
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bga00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BG0657
Enzymes [BR:bga01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.21  nicotinate phosphoribosyltransferase
     BG0657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(673700..675145)
Genome map
AA seq 481 aa AA seqDB search
MKNLSLFTDFYEISMMNAYFTKGINPKAKFEVFFRKTPFKNGYIVLAGMHTLINELKNIC
FNENQLKYLKSLNILDKQFLNFLREFKLNIKISSIEEGRLVFPYTPVAVIEGNLIELLLI
EGLVLNIINFESLIATKTARIKESGAKILAELGLRRAQGINGALSASKAAYIGGADFTSN
MLAGYKYNIPVTGTMAHSWIMSFESEEQAFREYAKTYPNKVSLLIDTYDTLNSGLKNAIK
IFKELKQEEKNKFSIRIDSGDLEYLSKEARKELNRNGLNHVKIIASNELDENIIMYLNSI
NAPIDIWGVGTNLVTAKGDPNLSGVYKMISIEKNGKFIPKMKISNNIEKSTLPDQKEVAR
IYLNGQMIFDFIFLKEEKDEIKDHLNLRKEFTIFHPIQDNVFKIIKQYDDFEFLIHAVLE
NGKLCKGYESSLNNIRNKTKLDLSRLEHTYRRIINPHIYKVSISKNLRKLRNKLIKDNKS
N
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatctatcactattcacagatttttatgaaatttcaatgatgaatgcttatttt
acaaaaggcattaatcctaaagcaaaatttgaggttttttttagaaaaacaccgtttaaa
aatggttatattgttttagctggaatgcatacattaattaatgaattaaaaaatatttgt
ttcaatgaaaatcaacttaaatatttaaaaagcttgaatatacttgataaacaattttta
aactttctcagagaattcaaactaaacataaaaataagctcaatagaagaaggtcgcctg
gtcttcccctataccccagtagctgtgattgaagggaatctaatagaattactattaata
gaaggactggttttaaatataataaactttgaaagtttaatagcaacaaaaaccgcaaga
ataaaagaatctggtgcaaaaattttagcagaacttgggttaagaagagcacaaggaata
aatggcgcactctctgctagcaaagccgcctacataggaggagcggactttacaagtaat
atgcttgctgggtataaatacaatataccagtcacaggaacaatggcccatagttggata
atgagttttgaaagcgaagaacaagcatttagagaatatgcaaagacctatccaaacaaa
gtaagtttactaattgatacttatgacacgcttaatagtggattaaaaaatgctattaag
atatttaaggagctaaaacaagaggaaaaaaataaattttcaataagaattgacagtggg
gatcttgaatatttaagtaaagaagcaagaaaagaattaaaccgaaatggattaaatcac
gtaaaaattattgcatctaatgagcttgacgaaaatattatcatgtatctaaattcaata
aatgctccaattgatatttggggcgttggaacaaatctagttacagcaaaaggagatcca
aatctttcaggagtatataaaatgatctctatagaaaaaaatggaaaatttataccaaaa
atgaaaatatcaaataacatagaaaaatcaacattacctgaccaaaaagaagttgcaaga
atctatttaaatggtcaaatgatctttgattttatatttttgaaagaagaaaaagatgaa
attaaagaccatctaaacttaagaaaagaatttaccatttttcatccaatacaagataat
gttttcaaaattatcaaacaatatgacgattttgaatttttaattcacgctgtcttagaa
aatggaaaactttgcaaaggctatgaatctagtttaaacaacattagaaataaaacgaag
cttgacttaagtagacttgaacatacttacagaagaataattaatccccatatatataaa
gtaagtataagtaaaaacttaagaaagttaagaaacaaactcataaaagataataaaagt
aattaa

DBGET integrated database retrieval system