KEGG   Borrelia garinii PBi: BG0681Help
Entry
BG0681            CDS       T00194                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bga  Borrelia garinii PBi
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BG0681 (gpmA)
   01230 Biosynthesis of amino acids
    BG0681 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BG0681 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BG0681 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BG0681 (gpmA)
Enzymes [BR:bga01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BG0681 (gpmA)
Exosome [BR:bga04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BG0681 (gpmA)
  Exosomal proteins of melanoma cells
   BG0681 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
699508..700254
Genome map
AA seq 248 aa AA seqDB search
MYKLVLVRHGESEWNKENLFTGWTDVKLSDKGINEALEAGLLLKQEGYSFDIAFSSLLSR
ANDTLNIILRELGQSYISVKKTWRLNERHYGALQGLNKSETAAKYGEGKVLIWRRSYDVP
PMSLDESEDRHPIKDPRYKYIPKRELPSTECLKDTVTRVIPYWTDEIAKEVLGGKKVIVA
AHGNSLRALVKYLDNLSEEDVLKLNIPTGIPLVYELDKDLNPIKHYYLGDESKIKSAMES
VASQGKLK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtataaattagttttagtgaggcatggagagagtgaatggaacaaagaaaatcttttt
actggttggacagatgttaaactttctgacaagggtatcaatgaggctttagaagcaggt
ttgctcctaaagcaagaaggctattcttttgatattgcttttagttctttattgtcaagg
gctaatgatactttaaatattattttgcgagaattggggcaatcttatattagtgtaaaa
aaaacctggagattaaatgagaggcactatggagctttacaaggtttaaataagtcagaa
acagctgcaaaatatggggaaggtaaagttttaatttggagacgcagttatgatgtgccc
ccaatgtctttagatgagtctgaagatcgtcatccaataaaagatccaagatataaatat
attcctaaaagggagcttccttcaacagaatgccttaaagatactgttacaagagttatt
ccttattggactgatgagattgcaaaagaagttcttgggggtaaaaaagttattgttgct
gctcatggcaattctttaagagctcttgttaaatatcttgataatttaagcgaagaagat
gttttaaagcttaacattcctacgggtattcctttagtttatgaattagataaagattta
aatcctattaaacattactatttaggtgatgaaagtaagattaaaagtgcaatggaatct
gttgctagtcaaggaaagttaaagtaa

DBGET integrated database retrieval system