KEGG   Borrelia garinii PBi: BG0749Help
Entry
BG0749            CDS       T00194                                 

Gene name
pfk
Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bga  Borrelia garinii PBi
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:bga01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bga01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bga00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bga00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bga00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bga00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:bga00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
767273..768616
Genome map
AA seq 447 aa AA seqDB search
MYRIKNENLDFKIDSLGECKQNNPLIDFYAGEGSSHFVNEKNKIKFSVYRNEDEGDKYED
ILLEKAGPREKIYFVPRHVKAAITTCGGLCPGFNDVIRSIVRTLWKIYGVRNIYGVKFGY
QGLLPESNSPFINLNPDVGDDINKFGGTILGSSRGGIKPVEIVDTLERMNINMIFNIGGD
GTQKGSLLIAEEIEKRNLKIAVVGIPKTVDNDFMFVQKSFGFETAVEQAVAAVAGAHFEA
NSAYNGIGLVKVMGRDSGFIAAHTALSSNDVNFCLIPELDFDIEGPNGFLVHLERRLLEK
ESLEEIPHAVILIAEGAGQKYFNQFPRKKDDSGNLLYEDIGLYIKDKITEYFKAKNIQFT
LKYIDPSYIIRSSPANASDSLYCARLGSNAVHAAMSGKTKMLISLWSTKFVHIPIKMAVI
DRNKVNPNGSFWRDVLSSTGQPISMKN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtgtatagaattaaaaatgaaaatttagattttaaaatagatagtttaggggaatgcaag
caaaacaatcctttgattgatttttatgctggtgagggctcttcacattttgttaatgaa
aaaaataaaattaaatttagtgtatatagaaatgaggacgagggagataagtatgaagat
attcttttagaaaaagctggacctagagaaaaaatttattttgtgcccaggcacgttaaa
gctgctattactacttgcggtggactttgtcctggctttaacgatgttattcgttctatt
gtgcgaactttatggaaaatttatggggttcgtaatatttatggggtaaaatttggatat
caaggtcttcttcctgagtcaaattcaccttttattaatcttaatccagatgttggtgat
gatattaataaatttggaggcactattcttggctcttcaaggggtggtattaaacccgtt
gaaatagttgacactttggagagaatgaacattaatatgatttttaatattggtggagat
ggtactcaaaaggggtctcttcttattgctgaggagatagaaaaaagaaatttaaaaata
gcggttgtaggcattcctaaaactgtagacaatgattttatgtttgttcaaaaatctttt
ggatttgagaccgctgtagaacaagcggttgcagctgttgctggtgctcattttgaagct
aatagtgcttataatggtattggacttgttaaagttatggggcgggattctgggtttatt
gctgctcatactgcgctttcttctaatgatgttaatttttgtttaattccagagcttgat
tttgatatagaaggtcctaatggatttcttgttcatcttgaaagacgacttttagagaaa
gagagcttagaggaaattcctcatgcagtaatattgatagcagaaggagcagggcaaaag
tattttaatcagtttcctcgcaaaaaagacgattctgggaatttgctttatgaggatatt
gggctttatattaaagataaaattacagaatattttaaagcaaaaaatatacaatttact
cttaaatacattgatcccagctatattattagaagttcgcctgctaatgctagtgattca
ctttattgtgctaggcttggttcaaatgctgtgcatgctgcaatgtctggcaagacaaaa
atgttgattagtttgtggagtacaaagtttgtgcacataccgattaagatggcagtaatt
gacagaaataaggttaatcccaatggttctttttggagagatgttctttcaagcacagga
caaccgattagcatgaagaattaa

DBGET integrated database retrieval system