KEGG   Borrelia garinii BgVir: KK9_0054Help
Entry
KK9_0054          CDS       T02048                                 

Gene name
tpiA
Definition
(GenBank) TpiA
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bgb  Borrelia garinii BgVir
Pathway
bgb00010  Glycolysis / Gluconeogenesis
bgb00051  Fructose and mannose metabolism
bgb01100  Metabolic pathways
bgb01110  Biosynthesis of secondary metabolites
bgb01120  Microbial metabolism in diverse environments
bgb01130  Biosynthesis of antibiotics
bgb01200  Carbon metabolism
bgb01230  Biosynthesis of amino acids
Module
bgb_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bgb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KK9_0054 (tpiA)
   00051 Fructose and mannose metabolism
    KK9_0054 (tpiA)
   00562 Inositol phosphate metabolism
    KK9_0054 (tpiA)
Enzymes [BR:bgb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     KK9_0054 (tpiA)
Exosome [BR:bgb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   KK9_0054 (tpiA)
  Exosomal proteins of bladder cancer cells
   KK9_0054 (tpiA)
  Exosomal proteins of melanoma cells
   KK9_0054 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEW68395
Position
linear:complement(50167..50928)
Genome map
AA seq 253 aa AA seqDB search
MRKTFLAGNWKMHYTSTEASIVAKKIATEVKTLKDDFVIMITPPFTALSKVSECIKGSNI
LLGAQNMSYMESGARTSEISPSMLLEFGVEYVILGHSECRLYLGETDEIINKKILAGLKH
PFKYLILCVGETLNERDSGKTLDVVLNQVKKGLDGVSESDIKRIILAYEPVWAIGTGKTA
TKEEAEEVHKAIRLEIMNLYSKSVSDNVIIQYGGSVNSSNVKELMNEPDIDGALIGGASL
KAESFLSIINNVL
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaaaacgtttttagcgggaaattggaaaatgcattatacaagcacagaagcttct
attgttgcaaaaaaaatcgcaactgaagttaaaactttaaaggatgattttgtaataatg
ataactcctccatttacggctttgtctaaggtttcagaatgtatcaagggtagcaatatt
cttcttggtgctcaaaatatgtcttatatggaaagtggagcaaggactagtgaaatttca
ccttcaatgcttttagaatttggagtagagtatgttatacttggtcattccgaatgtaga
ttgtatttgggagaaacagatgaaataataaataaaaagattcttgcggggcttaagcat
ccttttaagtacttaattctttgcgttggagaaactcttaatgagagagattctggaaaa
actttagatgttgttttaaatcaggttaaaaaggggctagatggcgtttctgaatcagat
attaaaagaataattttagcttatgaacctgtttgggcaattggaacaggcaaaactgca
actaaagaggaagcagaagaagttcataaggcaattaggcttgagattatgaatctttat
tcaaagtcggtttcggataatgttataattcaatatggaggctctgttaattcaagcaat
gtaaaagagcttatgaatgagcctgatattgatggtgctttaataggcggtgcatctttg
aaggccgaatcttttttatctatcattaataacgttctttag

DBGET integrated database retrieval system