KEGG   Borrelia garinii BgVir: KK9_0245Help
Entry
KK9_0245          CDS       T02048                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bgb  Borrelia garinii BgVir
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgb00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    KK9_0245 (glpK)
Enzymes [BR:bgb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     KK9_0245 (glpK)
Exosome [BR:bgb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KK9_0245 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
245636..247141
Genome map
AA seq 501 aa AA seqDB search
MKYILSIDQGTTSSRAIVFDKHANIKGLAQKEFTQIYPQPSWVEHDPTEIWGSQLGVITE
ALANSRILPNEVDAIGITNQRETTVIWEKSTGKPIYNAIVWQDRRTAKICDQLTKEGKDK
IILEKTGLVLDSYFSGTKILWILDNVEGARQKAENGELCFGTIDTWLLWNLTQKKVHATD
YSNASRTLLLNIKTLEWDDELLKILNIPKAILPELKESSTIYGETDKSIFGAEIPIAGIA
GDQFAATFGQACLKKGMAKNTYGTGCFLTVNIGKEPIINHERLLTSIAWGRKKTVTYVLE
GSVFIGGAVIQWLRDGLEFFRKSSDAESLASSASDNGGVYFVPAFVGLGAPHWDSYARGT
IIGITRGSTKAHITRAALESIAFQSFDILNTMKKSIPNFEIKELRVDGGASQNNLLMQFQ
ADLLECKVVRPKITETTALGAAYLAGLASGYWQSAEEIISLWQVDKIFEPSMPKNQKEKL
LENWNRAIERSKSWIQNSNSL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatattttatctattgatcaaggtactactagctcaagagcaatagtatttgat
aaacatgcaaacataaaagggcttgctcaaaaagaatttactcaaatttatccacaacca
agctgggtggagcatgatcctactgaaatatggggatcgcaacttggagttataacagaa
gctcttgcaaattcaagaattttaccaaatgaagttgatgctattggaataactaatcaa
agagaaactacagttatatgggaaaaaagcacaggaaaacctatttataatgcaatagta
tggcaagatagaagaactgcaaaaatttgtgaccaattaacaaaagagggaaaagataaa
attattttggaaaaaacaggcttggtactagattcttattttagtggtacaaaaatactg
tggatcttggataatgtagagggtgctagacaaaaagctgaaaatggtgaattgtgtttt
ggaacaatagatacatggctattatggaatctgactcaaaagaaagtacatgcaactgac
tattctaatgcttcaagaacattattgttaaacattaaaacattagaatgggatgatgaa
cttttaaagatattaaatattccaaaagcaattttacccgaacttaaagaaagctctaca
atatatggcgaaacagacaaatcgatatttggagcagaaattcctattgcaggaattgcc
ggagatcaatttgcagcaacatttggacaagcctgccttaaaaaaggtatggctaaaaac
acatatggaactggttgctttttaacggttaatataggcaaagaaccaattattaaccat
gaaagacttttaacttcaatcgcgtggggaagaaaaaaaaccgtaacttatgttcttgaa
ggaagtgtttttattggtggagctgtaatccagtggctaagagacggtcttgaatttttc
agaaaaagctcagatgcagaatcattggcaagctctgcttcagataatggaggagtttat
tttgtaccagcatttgttggacttggcgcacctcattgggattcttatgcaagaggaaca
atcatcggaataacaaggggatcgacaaaagcgcacattacaagagctgctcttgagagc
atagcatttcaaagttttgatatactaaataccatgaaaaaatccattcccaactttgaa
attaaagaattaagagtagacggaggagcaagtcaaaacaatctattaatgcaatttcaa
gctgatcttttagaatgtaaagttgtaagaccaaaaataacagaaacaacagcacttgga
gctgcttatcttgcaggacttgcatcaggttattggcaaagcgccgaggaaatcataagt
ctttggcaagtagataaaatatttgaaccttcaatgccaaaaaatcaaaaagaaaagctt
cttgaaaattggaacagagcaattgaaagatcaaaatcctggatacagaattccaatagt
ctataa

DBGET integrated database retrieval system