KEGG   Borrelia garinii BgVir: KK9_0425Help
Entry
KK9_0425          CDS       T02048                                 

Gene name
cheB-1
Definition
CheB-1
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bgb  Borrelia garinii BgVir
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bgb02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:bgb02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
426363..427490
Genome map
AA seq 375 aa AA seqDB search
METKISVLIIEYFAVKRKLISDLINSSPKLQVIATASNGKFATNKLKKHNPEVILMNLEE
NNIKDILFLEKKNNINKTIPIIVTSSNQNLINIAALKGADDLILVSKNKKSHENKKEQII
NSLLAYGSISIKNKIVCNKDMKIKNYEGARFFLNHKNDIFSLNKLEEHTKEKILNEKEIK
KLKLRKFDIIAIGISAGGPVALKSILPEIPESFPPIIIVQHMPKGFTEEFAKNLNNLCKI
RVKETANKEILKQGHAYISSGGYHTKIQKIDGNYQIQIFDGKHINGHKPSIGVLFQSIAE
IAKDKAIALIMTGMGNDGSREIGNIKKAGGLTIAQDKESSMVFGMPKIAIKENNIDYIVP
LNHMVKLLKAILIDS
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtggaaacaaaaatttctgtacttatcatagaatactttgctgtaaagagaaagcttata
tcagaccttattaattcgtctcccaaactccaagtcattgcaactgcttctaatggcaaa
tttgcaaccaataagcttaaaaaacataatcccgaagtaatactaatgaatttagaagaa
aataacattaaagatattctctttttggagaaaaaaaataatataaacaaaacaatacca
attatagtcacatcttcaaatcaaaacctaataaatattgctgctttaaagggagctgat
gatcttatactagtatctaaaaataaaaaatcacatgaaaacaaaaaagaacaaattatt
aattctcttttggcctatggatcaatatctataaaaaacaaaattgtttgcaataaggat
atgaaaataaaaaactatgagggagctagattttttttaaatcacaaaaatgacattttt
tcattaaataaacttgaagaacatacaaaagaaaaaatattaaatgaaaaagaaataaaa
aaacttaaacttagaaaattcgacataatagcaattggaatatcagcagggggtcctgtg
gccttgaaatcaatattaccagaaatacctgaaagcttccccccaataataattgttcaa
catatgcctaaaggatttacagaagaatttgcaaaaaatcttaataatctttgcaaaata
agggtaaaagaaaccgccaataaagaaatattaaagcaaggacatgcatacataagctca
ggtggatatcatacaaaaattcaaaaaatcgatggcaactatcaaatacaaatcttcgat
ggcaaacatataaatggccacaaaccatctatcggggtattatttcaatctattgcagaa
attgcaaaagataaagcaattgccctaataatgactggaatgggaaatgatggatcaaga
gaaattggcaatataaaaaaagctgggggactaactattgcgcaagataaagaaagttcc
atggtttttggaatgcccaaaatagcaataaaagaaaacaatatagactatatagttcca
ctaaaccatatggtaaaattattaaaagctatactaattgatagctaa

DBGET integrated database retrieval system