KEGG   Borrelia garinii BgVir: KK9_0650Help
Entry
KK9_0650          CDS       T02048                                 

Definition
Beta-glucosidase, putative
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bgb  Borrelia garinii BgVir
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bgb00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:bgb00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(649232..650827)
Genome map
AA seq 531 aa AA seqDB search
MEREKLINEMVNKMQDHELLGQMFMISYPNQSITNFVLDFISKKNLGGIKIFGWNAKNLK
NLIESINKAQKTSQNNKFKIPLFVATDQEGGLAQHIKLNTSETIGNLGIAASLSPKDSYN
TGYYIAQELSQLGINLNFAPIVDIYSDENNFTIGPRTYSDNPKIVSLFSLAFYKGQKQGG
IISTAKHFPGHGNTTLDSHINIPIINSNLLEINLNELLPYKILIQENIPVIMTGHIAYPK
LTNGENIPASSSTKIIKDILRKKLKYNNIIITDDLLMNAVKYNNESIYNTIERIVRTKSD
IFLISLNENIQKNAYNMLLGLMKKDSEIKNNIIESNKRILRIKLEYLKENKNQSDLYPNF
NKNEKIYSKEGEKFFEQSTLRGITKVRIEKEISKTKKTLIISPYYKMIAEGKKIFQNTYA
YYYNYYPLNRINPQKLDEIKKLIKKFDQVIFNLSTPGSLKYLENLKEYKDKISVIVSLTP
QHIKKLNWIKNIVIIYGTTPLAFKSGLLTLTKDFDPKGTIPLRDITNKYYP
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggaaagagaaaaactaataaacgaaatggtaaacaaaatgcaagaccatgagctatta
ggacaaatgtttatgataagctatccaaatcagtcaataacaaattttgttcttgatttt
ataagtaaaaaaaaccttggtggaattaaaatttttggatggaacgcaaaaaatttaaaa
aacttaatagaaagtattaataaagctcaaaaaacatctcaaaataataaatttaaaatt
cctttatttgtagcaacagatcaagaaggggggttggcacagcacataaaattaaataca
tcagaaacaattggtaatcttgggattgcagcatctctatctccaaaagattcttacaac
acaggatattatatagcacaagagctaagtcagcttggaataaatttaaattttgcaccc
atagtagatatatatagtgacgaaaataatttcacaataggaccaagaacatattcagat
aaccctaaaatagtatcacttttttctctggccttttacaaaggacaaaagcaaggagga
ataatttctactgcaaagcatttcccaggacacggcaatactactcttgactcccatata
aatattccaataataaattctaatttactagaaataaatttaaatgaacttttgccatat
aaaatattaatccaagaaaacattcctgtaataatgacaggccatatagcatatccaaag
cttacaaatggagaaaatattcctgcatcatcctcaacaaaaataattaaagatatacta
agaaaaaaattaaagtataataacataataattaccgatgacctattaatgaatgcagta
aaatacaataatgagagtatttataatacaatcgaaagaatagttagaaccaaaagtgac
atttttttaatatctttaaatgaaaatatacaaaaaaatgcttacaacatgttactaggc
ttaatgaaaaaagattcagaaataaaaaacaatattattgaatctaataaaagaatatta
agaataaaattggaatacttaaaagaaaataaaaatcaatctgatctttatcctaatttc
aataaaaatgagaaaatatattcaaaagaaggtgaaaaatttttcgaacaaagcacatta
agaggtattacaaaagtaagaatagaaaaagaaatatctaaaactaaaaaaacccttata
atatctccttattacaaaatgattgcagaaggcaaaaaaatatttcaaaatacatatgct
tattattataactattatcccttaaataggattaatccccaaaaactcgacgaaattaaa
aaattaattaaaaaatttgatcaagtaatctttaatttatcaacacccggaagcttaaaa
tacttagaaaatttgaaagaatataaagacaaaataagtgtaattgtatctcttacgcct
caacatattaaaaaattaaattggataaaaaacatagtaatcatttatggaacaacaccc
ctggcatttaaatctggacttttaacactcactaaggattttgatccaaaaggaactatc
cctttaagggatatcacaaataaatattatccttaa

DBGET integrated database retrieval system