KEGG   Borrelia garinii BgVir: KK9_0665Help
Entry
KK9_0665          CDS       T02048                                 

Gene name
recD
Definition
Exodeoxyribonuclease V, alpha chain
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bgb  Borrelia garinii BgVir
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bgb03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(665753..667588)
Genome map
AA seq 611 aa AA seqDB search
MRDFLVLREFLKDKNKKFLIPELKLYEMIELLNINKKNYYKAQTLTKSINDENIVIFLIF
LFNYYDKGHLRANIKLLAKDIQNTITLTKDNLEKTNKSYNKSIKILKELEIFGNLENINN
IVSLLKKNNILMEFNKLKITTPLILENNIYIYTQKNYREEEELIKQIIKRLENHKSELND
NEIQNIISNLNTSNLNKEQITSVRKALKSNFFLLSGGPGTGKTTTINYILKAINQTLNNK
KKGLVAITAPTGKASLRLQTSIDYSFKNLEIECNTIQKLLGIKFINKKNLYDEENQLNFD
VIIIDEASMVDAYTFLKLLKATPITTKLIIVGDKNQLPSVNEGNVYSSLLGIKKINNDNV
EDLKENFRSNKEINLLSKAIYKEDSTLICKYINNNNKNIKLKEIEKINLKKDLIEYINNL
YRKISTFNLKLLKESKIETILETLLENIILSSKNFGKFGTKTLNEIIKNYLKKTYGDFIG
QIIMITKTDYKNKLFNGERGIIFNENSKFYALFQRKNEKYKKINLDLLTNYEFSFAITIH
KSQGSEYKHIKVILENNPFLTKELMYTAITRAKDSLEIISNKETVLKLSKKSSKRDSKIL
EHLNSFKEIDK
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgagagattttttagtattaagagaatttttaaaagataaaaacaaaaaattcttaatt
cctgagcttaagctttatgaaatgattgaacttttaaatatcaataaaaaaaattattat
aaagcacaaacacttacaaagtccataaacgatgaaaatattgtaatatttttaatattt
ttatttaactactatgataaaggccacttaagagctaatataaagctattagcaaaagat
attcaaaatacaataacattaacaaaagacaacctggaaaaaaccaataaaagttataac
aaatcaataaaaattctaaaagagttagaaatatttgggaatctagaaaatattaataat
atagtctcacttttaaaaaaaaataatatactaatggaatttaataaacttaaaattaca
actcccctaatcctagaaaacaatatctacatttatactcaaaaaaactatagagaagaa
gaagagttaataaaacaaattataaaaagattagaaaaccataaaagtgaattaaatgac
aacgaaatacaaaatataatatcaaatttaaacaccagtaatttaaataaagagcaaatt
acatcagtgagaaaagcattaaaaagcaacttctttttattgagcggaggccctggaaca
ggcaaaaccacaactattaactatatcttaaaagcaattaatcaaacattgaacaataaa
aaaaaaggattagtagcaattacagcacctacaggaaaagctagcttaagactacaaaca
agtattgactattcattcaaaaatttagaaatagaatgcaatacaatccaaaaactattg
ggaatcaaatttataaacaaaaaaaatctatatgatgaagaaaatcaactaaattttgat
gtaataataattgacgaagcttcaatggtagatgcatatacttttttaaagctattaaaa
gcaacaccaataactactaaattaataatagtaggagataaaaatcaactcccatcggta
aatgaaggaaatgtatattcaagtcttctaggaataaaaaaaataaataacgacaatgta
gaagatcttaaagaaaattttagaagcaacaaagaaataaacttgctctcaaaagccata
tacaaagaagatagtaccttgatttgcaaatacattaataacaataataaaaatattaaa
ttaaaagaaatagaaaaaataaacttaaaaaaagatctaatagaatatataaacaattta
tatagaaaaatatccacttttaatcttaaattactaaaagaatcaaaaattgaaacaata
cttgaaactttgcttgaaaatataattttaagttcaaagaattttggaaaatttggaact
aaaacactaaatgaaataataaaaaattacctaaaaaagacctatggggactttattggt
caaataataatgataactaaaactgactataaaaataaattatttaatggagaacggggc
atcatttttaatgaaaattctaagttttatgctttatttcaaagaaaaaatgaaaaatat
aaaaaaataaatttagatttactaacaaattatgaattcagctttgctataacaatacac
aaaagccaaggatctgaatacaaacatataaaagtaatattagaaaataacccttttttg
acaaaagaacttatgtatactgcaataacaagggctaaagatagtttagaaataatttct
aacaaagagactgttcttaagctaagtaaaaaatctagcaaaagagattcaaaaatacta
gaacacttaaactcatttaaagaaattgacaaataa

DBGET integrated database retrieval system