KEGG   Borrelia garinii BgVir: KK9_0691Help
Entry
KK9_0691          CDS       T02048                                 

Gene name
gpmA
Definition
GpmA
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bgb  Borrelia garinii BgVir
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bgb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KK9_0691 (gpmA)
   01230 Biosynthesis of amino acids
    KK9_0691 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KK9_0691 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    KK9_0691 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KK9_0691 (gpmA)
Enzymes [BR:bgb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     KK9_0691 (gpmA)
Exosome [BR:bgb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   KK9_0691 (gpmA)
  Exosomal proteins of melanoma cells
   KK9_0691 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
700158..700904
Genome map
AA seq 248 aa AA seqDB search
MYKLVLVRHGESEWNKENLFTGWTDVKLSERGINEALEAGLLLKQEGYSFDIAFSSLLSR
ANDTLNIILRELGQSYISVKKTWRLNERHYGALQGLNKSETAAKYGEDKVLIWRRSYDVP
PMSLDESDDRHPIKDPRYKYIPKRELPSTECLKDTVTRVIPYWTDEIAKEVLEGKKVIVA
AHGNSLRALVKYLDNLSEEDVLKLNIPTGIPLVYELDKDLNPIKYYYLGDESKIKSAMES
VASQGKLK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtataaattagttttagtgaggcatggagagagtgaatggaacaaagaaaatcttttt
actggttggacagatgttaaactttctgagaggggtatcaatgaggctttagaggcaggt
ttgctcctaaagcaagaaggctattcttttgatattgcttttagttctttattgtcaagg
gctaatgatactttaaatattattttgcgagaattagggcaatcttatattagtgtaaaa
aaaacctggagattaaatgagaggcactatggagctttacaaggtttaaataagtcagaa
acagctgcaaaatacggggaagataaagttttaatttggagacgcagttatgatgtgccc
ccaatgtctttagatgagtccgacgatcgccatccaataaaagatccaagatataaatat
attcctaaaagggagcttccttcaacagaatgccttaaagatactgttacaagagttatt
ccttattggactgatgagattgcaaaagaagtccttgagggtaaaaaagttattgttgct
gctcatggcaattctttaagagctcttgttaaatatcttgataatttaagcgaagaagat
gttttaaagcttaacattcctacgggtattcctttagtttatgaattagataaagattta
aatcctattaaatattactatttaggtgatgaaagtaagattaaaagtgcaatggaatct
gttgccagtcaaggaaagttaaagtaa

DBGET integrated database retrieval system