KEGG   Borrelia garinii BgVir: KK9_0691Help
Entry
KK9_0691          CDS       T02048                                 

Gene name
gpmA
Definition
(GenBank) GpmA
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bgb  Borrelia garinii BgVir
Pathway
bgb00010  Glycolysis / Gluconeogenesis
bgb00260  Glycine, serine and threonine metabolism
bgb00680  Methane metabolism
bgb01100  Metabolic pathways
bgb01110  Biosynthesis of secondary metabolites
bgb01120  Microbial metabolism in diverse environments
bgb01130  Biosynthesis of antibiotics
bgb01200  Carbon metabolism
bgb01230  Biosynthesis of amino acids
Module
bgb_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bgb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KK9_0691 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    KK9_0691 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KK9_0691 (gpmA)
Enzymes [BR:bgb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     KK9_0691 (gpmA)
Membrane trafficking [BR:bgb04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    KK9_0691 (gpmA)
Exosome [BR:bgb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   KK9_0691 (gpmA)
  Exosomal proteins of melanoma cells
   KK9_0691 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEW68992
Position
linear:700158..700904
Genome map
AA seq 248 aa AA seqDB search
MYKLVLVRHGESEWNKENLFTGWTDVKLSERGINEALEAGLLLKQEGYSFDIAFSSLLSR
ANDTLNIILRELGQSYISVKKTWRLNERHYGALQGLNKSETAAKYGEDKVLIWRRSYDVP
PMSLDESDDRHPIKDPRYKYIPKRELPSTECLKDTVTRVIPYWTDEIAKEVLEGKKVIVA
AHGNSLRALVKYLDNLSEEDVLKLNIPTGIPLVYELDKDLNPIKYYYLGDESKIKSAMES
VASQGKLK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtataaattagttttagtgaggcatggagagagtgaatggaacaaagaaaatcttttt
actggttggacagatgttaaactttctgagaggggtatcaatgaggctttagaggcaggt
ttgctcctaaagcaagaaggctattcttttgatattgcttttagttctttattgtcaagg
gctaatgatactttaaatattattttgcgagaattagggcaatcttatattagtgtaaaa
aaaacctggagattaaatgagaggcactatggagctttacaaggtttaaataagtcagaa
acagctgcaaaatacggggaagataaagttttaatttggagacgcagttatgatgtgccc
ccaatgtctttagatgagtccgacgatcgccatccaataaaagatccaagatataaatat
attcctaaaagggagcttccttcaacagaatgccttaaagatactgttacaagagttatt
ccttattggactgatgagattgcaaaagaagtccttgagggtaaaaaagttattgttgct
gctcatggcaattctttaagagctcttgttaaatatcttgataatttaagcgaagaagat
gttttaaagcttaacattcctacgggtattcctttagtttatgaattagataaagattta
aatcctattaaatattactatttaggtgatgaaagtaagattaaaagtgcaatggaatct
gttgccagtcaaggaaagttaaagtaa

DBGET integrated database retrieval system