KEGG   Borrelia garinii BgVir: KK9_0761Help
Entry
KK9_0761          CDS       T02048                                 

Gene name
pfk
Definition
Pfk
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bgb  Borrelia garinii BgVir
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bgb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KK9_0761 (pfk)
   01230 Biosynthesis of amino acids
    KK9_0761 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KK9_0761 (pfk)
   00030 Pentose phosphate pathway
    KK9_0761 (pfk)
   00051 Fructose and mannose metabolism
    KK9_0761 (pfk)
   00052 Galactose metabolism
    KK9_0761 (pfk)
  Energy metabolism
   00680 Methane metabolism
    KK9_0761 (pfk)
Enzymes [BR:bgb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     KK9_0761 (pfk)
Protein phosphatases and associated proteins [BR:bgb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     KK9_0761 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
767936..769279
Genome map
AA seq 447 aa AA seqDB search
MYRIKNENLDFKIDSLGECKQNNPLIDFYAGEGSSHFVNEKNKIKFSVYRNEDEGDKYED
ILLEKAGPREKIYFVPRHVKAAITTCGGLCPGFNDVIRSIVRTLWKIYGVRNIYGVKFGY
QGLLPESNSPFINLNPDVVDDINKFGGTILGSSRGGIKPVEIVDTLERMNINMIFNIGGD
GTQKGSLLIAEEIEKRNLKIAVVGIPKTVDNDFMFVQKSFGFETAVEQAVAAVAGAHFEA
NSAYNGIGLVKVMGRDSGFIAAHTALSSNDVNFCLIPELDFDIEGPNGFLVHLERRLLEK
ESLEEIPHAVILIAEGAGQKYFNQFSRKKDDSGNLLYEDIGLYIKDKITEYFKAKNIQFT
LKYIDPSYIIRSSPANASDSLYCARLGSNAVHAAMSGKTKMLISLWSTKFVHIPIKMAVI
DRNKVNPNGSFWRDVLSSTGQPISMKN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtgtatagaattaaaaatgaaaatttagattttaaaatagatagtttaggagaatgcaag
caaaacaatcctttgattgatttttatgctggtgagggctcttcacattttgttaatgaa
aaaaataaaattaagtttagtgtatatagaaatgaggacgagggagataagtatgaagat
attcttttagaaaaagctggacctagagaaaaaatttattttgtgcccaggcacgttaaa
gctgctattactacttgcggtggactttgtcctggctttaacgatgttattcgttctatt
gtgcgaactttatggaaaatttatggggttcgtaatatttatggggtaaaatttggatat
caaggccttcttcctgagtcaaattcaccttttattaatcttaatccagatgttgttgat
gatattaataaatttggaggcactattcttggctcttcaaggggtggtattaaacctgtt
gaaatagttgacactttggagagaatgaacattaatatgatttttaatattggtggagat
ggtactcaaaaggggtctcttcttattgctgaggagatagaaaaaagaaatttaaaaata
gcggttgtaggcattcctaaaactgtagacaatgattttatgtttgttcaaaaatctttt
ggatttgagactgctgtagaacaagcggttgcagctgttgctggtgctcattttgaagct
aatagtgcttataatggcattggacttgttaaagttatggggcgggattctgggtttatt
gctgctcatactgcgctttcttctaatgatgttaatttttgtttaattccagagcttgat
tttgatatagaaggtcctaatggatttcttgttcatcttgaaagacgacttttagagaaa
gagagcttagaagaaattccccatgcagtaatattgatagcagaaggagcagggcaaaag
tattttaatcagttttctcgcaaaaaagacgattctgggaatttgctttatgaggatatt
gggctttatattaaagataaaattacagaatattttaaagcaaaaaatatacaatttact
cttaaatacattgatcctagctatattattagaagttcgcctgctaatgctagtgattca
ctttattgtgctaggcttggttcaaatgctgtgcatgctgcaatgtctggcaagacaaaa
atgttgattagtttgtggagtacaaagtttgtgcacataccgattaagatggcagtaatt
gacagaaataaggttaatcccaatggttctttttggagagatgttctttcaagcacagga
caaccgattagcatgaagaattaa

DBGET integrated database retrieval system