KEGG   Borrelia garinii BgVir: KK9_0761Help
Entry
KK9_0761          CDS       T02048                                 

Gene name
pfk
Definition
(GenBank) Pfk
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bgb  Borrelia garinii BgVir
Pathway
bgb00010  Glycolysis / Gluconeogenesis
bgb00030  Pentose phosphate pathway
bgb00051  Fructose and mannose metabolism
bgb00052  Galactose metabolism
bgb00680  Methane metabolism
bgb01100  Metabolic pathways
bgb01110  Biosynthesis of secondary metabolites
bgb01120  Microbial metabolism in diverse environments
bgb01130  Biosynthesis of antibiotics
bgb01200  Carbon metabolism
bgb01230  Biosynthesis of amino acids
bgb03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:bgb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KK9_0761 (pfk)
   00030 Pentose phosphate pathway
    KK9_0761 (pfk)
   00051 Fructose and mannose metabolism
    KK9_0761 (pfk)
   00052 Galactose metabolism
    KK9_0761 (pfk)
  Energy metabolism
   00680 Methane metabolism
    KK9_0761 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    KK9_0761 (pfk)
Enzymes [BR:bgb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     KK9_0761 (pfk)
Protein phosphatases and associated proteins [BR:bgb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     KK9_0761 (pfk)
Messenger RNA biogenesis [BR:bgb03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     KK9_0761 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AEW69059
Position
linear:767936..769279
Genome map
AA seq 447 aa AA seqDB search
MYRIKNENLDFKIDSLGECKQNNPLIDFYAGEGSSHFVNEKNKIKFSVYRNEDEGDKYED
ILLEKAGPREKIYFVPRHVKAAITTCGGLCPGFNDVIRSIVRTLWKIYGVRNIYGVKFGY
QGLLPESNSPFINLNPDVVDDINKFGGTILGSSRGGIKPVEIVDTLERMNINMIFNIGGD
GTQKGSLLIAEEIEKRNLKIAVVGIPKTVDNDFMFVQKSFGFETAVEQAVAAVAGAHFEA
NSAYNGIGLVKVMGRDSGFIAAHTALSSNDVNFCLIPELDFDIEGPNGFLVHLERRLLEK
ESLEEIPHAVILIAEGAGQKYFNQFSRKKDDSGNLLYEDIGLYIKDKITEYFKAKNIQFT
LKYIDPSYIIRSSPANASDSLYCARLGSNAVHAAMSGKTKMLISLWSTKFVHIPIKMAVI
DRNKVNPNGSFWRDVLSSTGQPISMKN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtgtatagaattaaaaatgaaaatttagattttaaaatagatagtttaggagaatgcaag
caaaacaatcctttgattgatttttatgctggtgagggctcttcacattttgttaatgaa
aaaaataaaattaagtttagtgtatatagaaatgaggacgagggagataagtatgaagat
attcttttagaaaaagctggacctagagaaaaaatttattttgtgcccaggcacgttaaa
gctgctattactacttgcggtggactttgtcctggctttaacgatgttattcgttctatt
gtgcgaactttatggaaaatttatggggttcgtaatatttatggggtaaaatttggatat
caaggccttcttcctgagtcaaattcaccttttattaatcttaatccagatgttgttgat
gatattaataaatttggaggcactattcttggctcttcaaggggtggtattaaacctgtt
gaaatagttgacactttggagagaatgaacattaatatgatttttaatattggtggagat
ggtactcaaaaggggtctcttcttattgctgaggagatagaaaaaagaaatttaaaaata
gcggttgtaggcattcctaaaactgtagacaatgattttatgtttgttcaaaaatctttt
ggatttgagactgctgtagaacaagcggttgcagctgttgctggtgctcattttgaagct
aatagtgcttataatggcattggacttgttaaagttatggggcgggattctgggtttatt
gctgctcatactgcgctttcttctaatgatgttaatttttgtttaattccagagcttgat
tttgatatagaaggtcctaatggatttcttgttcatcttgaaagacgacttttagagaaa
gagagcttagaagaaattccccatgcagtaatattgatagcagaaggagcagggcaaaag
tattttaatcagttttctcgcaaaaaagacgattctgggaatttgctttatgaggatatt
gggctttatattaaagataaaattacagaatattttaaagcaaaaaatatacaatttact
cttaaatacattgatcctagctatattattagaagttcgcctgctaatgctagtgattca
ctttattgtgctaggcttggttcaaatgctgtgcatgctgcaatgtctggcaagacaaaa
atgttgattagtttgtggagtacaaagtttgtgcacataccgattaagatggcagtaatt
gacagaaataaggttaatcccaatggttctttttggagagatgttctttcaagcacagga
caaccgattagcatgaagaattaa

DBGET integrated database retrieval system