KEGG   Burkholderia gladioli: bgla_1g02040Help
Entry
bgla_1g02040      CDS       T01464                                 

Definition
chemotaxis protein CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bgd  Burkholderia gladioli
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    bgla_1g02040
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    bgla_1g02040
Enzymes [BR:bgd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     bgla_1g02040
Two-component system [BR:bgd02022]
 CheA family
  CheA-CheYBV
   bgla_1g02040
Bacterial motility proteins [BR:bgd02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    bgla_1g02040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:226254..227330
Genome map
AA seq 358 aa AA seqDB search
MSTVQKIKVLCVDDSALIRSLMTEIINSQPDMAVCATAPDPLVARELIKQHNPDVLTLDV
EMPRMDGLDFLERLMRLRPMPVVMVSSLTERGSEITLRALELGAVDFVTKPRVGIRDGML
DYAEKLADKIRAAARARVRQAAPARPAAAAGLAGAPLVNNPLVSTEKLLIVGASTGGTEA
IRELLVPLPPDAPAVLIAQHMPPGFTKSFAQRLNTLCRIAVKEAEHGERVLPGHAYIAPG
HAHLLLARSGANYLAHLSDEPPVNRHRPSVDVLFRSAALHAGKNAIGVILTGMGRDGAAG
LLEMKRAGARTFAQDEASCVVFGMPREAIALGGADEVVPLNEMSRRVLAAMGERVQRV
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgtgcagaaaatcaaggtattgtgcgtcgacgattcggcgctgatccgcagc
ctgatgaccgagatcatcaacagccagcccgacatggcggtctgcgcgacggcgccggat
ccgctcgtcgcgcgcgagctgatcaagcagcacaacccggacgtgctgaccctggacgtg
gaaatgccgcgcatggacgggctcgacttcctggagcgcctgatgcggctgcgtccgatg
ccggtggtgatggtatcgtcgctgaccgagcgcggctcggaaatcaccttgcgcgcgctc
gagctcggcgcggtcgacttcgtcaccaagccgcgcgtggggattcgcgacggcatgctc
gactacgccgagaagctggccgacaagatccgcgcggcggcccgcgcgcgcgtgcggcag
gccgcgcccgccaggccggcggctgccgctggcctggcgggcgcgccgctggtgaacaat
ccgctggtcagtaccgagaagctgctgatcgtgggcgcctccacgggcggcaccgaggcg
atccgggagctgctggtgccgctgccgcccgacgcgccggcggtgctgatcgcgcagcac
atgccgcccggcttcaccaagtccttcgcgcagcgcctgaacacgctgtgccggatcgcg
gtgaaggaagccgagcatggcgagcgggtgctgccgggccatgcctatatcgcgcccggc
catgcccacctgctgctggcgcgcagcggcgcgaactacctggcccacctgtcggacgag
ccgccggtgaaccggcaccgtccctcggtcgacgtgctgttccgctcggcggcgctgcac
gcgggcaagaatgcgatcggcgtgatcctgaccggcatgggccgcgatggcgcggccggc
ctgctggagatgaagcgcgccggcgcgcgcaccttcgcgcaggacgaggccagctgcgtg
gtgttcggcatgccgcgcgaggcgatcgcgctgggcggggccgacgaggtggtgcccctg
aacgagatgagtcggcgcgtgctggccgcgatgggcgagcgtgtgcagcgcgtctga

DBGET integrated database retrieval system