KEGG   Burkholderia gladioli BSR3: bgla_1g03000Help
Entry
bgla_1g03000      CDS       T01464                                 

Definition
(GenBank) Translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
bgd  Burkholderia gladioli BSR3
Brite
Translation factors [BR:bgd03012]
 Eukaryotic Type
  Elongation factors
   bgla_1g03000
 Prokaryotic Type
   bgla_1g03000
Mitochondrial biogenesis [BR:bgd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    bgla_1g03000
Exosome [BR:bgd04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   bgla_1g03000
  Exosomal proteins of breast cancer cells
   bgla_1g03000
  Exosomal proteins of colorectal cancer cells
   bgla_1g03000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:354308..355498
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSSKFGGEAKKYDEIDAAPEEKARG
ITINTAHIEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDDTPIIKGSAKLALE
GDKGELGETAIMSLADALDTYIPTPERAVDGTFLMPVEDVFSISGRGTVVTGRVERGIVK
VGEEIEIVGIKDTQKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVERGQVLAKPGS
IKPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPKDKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKILD
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagagaagttcgaacggaccaagccgcacgtcaacgtcggtacgatcggtcac
gttgaccacggcaagacgacgctgacggcagccatcgcaacggttctgtcgtcgaagttc
ggcggcgaagcgaagaagtacgacgaaatcgacgcggcgccggaagaaaaggcacgtggt
atcacgatcaacaccgcgcacatcgagtacgaaacggcgaaccgccactacgcacacgtc
gattgcccgggccacgccgactatgtgaagaacatgatcacgggtgccgcgcagatggac
ggcgcgatcctggtgtgctcggccgccgacggcccgatgccgcaaacgcgtgagcacatc
ctgctggcgcgtcaggttggcgttccgtacatcatcgtgttcctgaacaagtgcgacatg
gtggacgacgctgaactgctcgagctggtcgagatggaagttcgcgaactcctgtcgaag
tacgacttcccgggcgacgacacgccgatcatcaagggttcggcgaagctggcgctggaa
ggcgacaagggcgagctgggcgagacggcgatcatgagcctggccgacgcgctggacacg
tacatcccgacgccggagcgcgcggtcgacggtacgttcctgatgccggtggaagacgtg
ttctcgatctcgggtcgcggcacggtggtgacgggtcgtgtcgagcgtggcatcgtgaag
gtcggcgaggaaattgaaatcgtcggcatcaaggacacgcagaagacgacctgcacgggc
gtggaaatgttccgcaagctgctggaccaaggtcaggctggcgacaacgtgggtatcctg
ctgcgcggtacgaagcgtgaagacgtggagcgtggccaggttctggccaagccgggttcg
atcaagccgcacacgcacttcacggctgaagtgtacgtgctgagcaaggacgaaggcggc
cgccacacgccgttcttcaacaactaccgtccgcagttctacttccgtacgacggacgtg
acgggctcgatcgagctgccgaaggacaaggaaatggtcatgccgggcgacaacgtgtcg
atcacggtgaagctgatcgctccgatcgcgatggaagaaggtctgcgcttcgcgatccgc
gaaggtggccgtaccgtcggcgccggcgtcgtcgccaagatcctcgactaa

DBGET integrated database retrieval system