KEGG   Burkholderia gladioli: bgla_1g03760Help
Entry
bgla_1g03760      CDS       T01464                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
bgd  Burkholderia gladioli
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    bgla_1g03760
  Amino acid metabolism
   00340 Histidine metabolism
    bgla_1g03760
Enzymes [BR:bgd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     bgla_1g03760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:421585..422913
Genome map
AA seq 442 aa AA seqDB search
MSIKIRKLDSSREGFAADLRAVLAFEASEDDAIERSVAAILADVKARGDAAVLDYTNRFD
RLQAASVAALELRQDALEAALEGLEPKRRAALEAAAARVRGYHEKQKLECGSHSWQYTES
DGTVLGQKVTPLDRVGLYVPGGKAAYPSSVLMNAIPARVAGVGEIVMVVPTPDGVSNELV
LAAAYLGGVDRVFTIGGAQAVAALAYGTETVPAVDKICGPGNAYVASAKRRVFGTVGIDM
IAGPSEILVICDGTTDPHWVAMDLFSQAEHDELAQSILLCPDAAFIERVEKAIDELLPSM
PREAVIRASLEGRGALVKVRDMAEACRIANDIAPEHLEISALEPQQWGKQIRHAGAIFLG
RYTSESLGDYCAGPNHVLPTSRTARFSSPLGVYDFIKRSSVIEVSAEGAQTLGEIASELA
YGEGLQAHARSAEYRMRHHGHH
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcaagattcgcaaactcgattccagccgcgaagggttcgcggccgacctgcgt
gcggtgctcgcgttcgaggcgagcgaggacgacgcgatcgagcgctcggtcgcggccatc
ctggccgacgtgaaggcgcgcggcgacgcggccgtgctcgactacacgaaccgcttcgac
cgcctgcaggccgccagcgtggccgcgctggagctgcgccaggacgcgctggaagccgcg
ctggaagggctcgagcccaagcgccgcgcggcgctggaggcggccgccgcgcgcgtgcgc
ggctaccatgagaagcagaagctcgagtgcggcagccatagctggcagtacaccgaatcg
gatggcacggtgctgggccagaaggtcacgccgctcgaccgcgtcggcctctacgtgccg
ggcggcaaggccgcctatccctcctcggtgctgatgaacgcgattccggcgcgggtcgcc
ggggtcggcgagatcgtgatggtggtgcccacccccgacggcgtgagcaacgagctggtg
ctggccgcggcctacctgggcggcgtcgatcgcgtgttcaccatcggcggcgcgcaggcg
gtggccgcgctcgcctacggcaccgaaaccgtgccggcggtcgacaagatctgcggcccg
ggcaatgcctatgtggcctcggccaagcgccgcgtgttcggcacggtcggcatcgacatg
atcgccgggccctccgagatcctggtgatctgcgacggcaccaccgatccgcactgggtg
gcgatggacctgttctcgcaggccgagcacgacgagctcgcgcagtcgatcctgctgtgc
cccgacgcggccttcatcgagcgcgtcgagaaggcgatcgacgagctgctgccgagcatg
ccgcgcgaggccgtgatccgcgcctcgctggaagggcgcggcgcgctggtcaaggtgcgc
gacatggccgaggcctgccggatcgccaacgacatcgcgcccgagcacctggagatctcc
gcgctcgagccgcagcaatggggcaagcagatccgccacgccggcgcgatcttcctcggc
cgctacaccagcgagagcctgggcgactactgcgcgggcccgaaccacgtgctgccgacc
tcgcgcaccgcgcgcttctcctcgccgctgggcgtctacgacttcatcaagcgctccagc
gtgatcgaggtcagcgccgagggcgcgcagacgctcggcgagatcgcctccgagctggcc
tacggcgaaggcctgcaggcgcatgcacgcagcgccgagtaccggatgcgccaccacggc
caccactga

DBGET integrated database retrieval system