KEGG   Burkholderia gladioli BSR3: bgla_1g04680Help
Entry
bgla_1g04680      CDS       T01464                                 

Definition
(GenBank) Thiol:disulfide interchange protein DsbC, putative
  KO
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
bgd  Burkholderia gladioli BSR3
Brite
Enzymes [BR:bgd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     bgla_1g04680
Chaperones and folding catalysts [BR:bgd03110]
 Protein folding catalysts
  Protein disulfide isomerase
   bgla_1g04680
Secretion system [BR:bgd02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   bgla_1g04680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:518567..519292
Genome map
AA seq 241 aa AA seqDB search
MKTTVRIAALVLATAAATLGCTAQADQTTDKLKTTLQARLGDATVKSIEKSPIPGLYEVN
LGSQIVYSDAAGDYVLLGDLVDTKTRKNLTEARMAEINKVDFASLPLNNAIKYVKGNGAR
KIAVFSDPNCPYCKRFESTLQSMDNITVYTFLYPVLTPDSTVKSKAIWCASDRAKSWENW
MVGHQPPSGAGNCDTSALDKNLALGRGLNVTGTPTIILADGTRLPGAVSADQLNSALAAV
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccacagtccgcatcgccgcgctcgtgctggcgaccgccgccgccacgctggga
tgcaccgcgcaggctgaccagaccaccgacaagctgaagaccacgctgcaggcgcgcctg
ggcgacgcgaccgtcaagagcatcgagaagtcgccgatcccgggcctctacgaagtgaat
ctcgggtcgcaaatcgtctacagcgacgcggcgggcgattacgtcctgctcggcgacctg
gtcgacaccaagacgcgcaagaacctgaccgaggcgcgcatggccgagatcaacaaggtc
gatttcgccagcctgccgctcaacaacgcgatcaagtacgtgaagggcaacggcgcgcgc
aagatcgctgtgttctcggatccgaactgcccctactgcaagcgcttcgaatcgacgctg
cagtcgatggacaacatcaccgtctataccttcctctacccggtgctgacgcccgattcg
acggtcaagtcgaaggcgatctggtgcgcctcggatcgcgccaagagctgggagaactgg
atggtcggccatcagccgccgagcggcgccggcaactgcgacacctcggcgctcgacaag
aacctggcgctgggacgtggcctgaacgtgacgggcacgcccaccatcatcctggcggac
ggcacgcgcctgccgggcgcggtgtccgccgaccagctcaacagcgcgctggccgccgtc
aagtga

DBGET integrated database retrieval system