KEGG   Burkholderia gladioli: bgla_1g04680Help
Entry
bgla_1g04680      CDS       T01464                                 

Definition
Thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
bgd  Burkholderia gladioli
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:518567..519292
Genome map
AA seq 241 aa AA seqDB search
MKTTVRIAALVLATAAATLGCTAQADQTTDKLKTTLQARLGDATVKSIEKSPIPGLYEVN
LGSQIVYSDAAGDYVLLGDLVDTKTRKNLTEARMAEINKVDFASLPLNNAIKYVKGNGAR
KIAVFSDPNCPYCKRFESTLQSMDNITVYTFLYPVLTPDSTVKSKAIWCASDRAKSWENW
MVGHQPPSGAGNCDTSALDKNLALGRGLNVTGTPTIILADGTRLPGAVSADQLNSALAAV
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccacagtccgcatcgccgcgctcgtgctggcgaccgccgccgccacgctggga
tgcaccgcgcaggctgaccagaccaccgacaagctgaagaccacgctgcaggcgcgcctg
ggcgacgcgaccgtcaagagcatcgagaagtcgccgatcccgggcctctacgaagtgaat
ctcgggtcgcaaatcgtctacagcgacgcggcgggcgattacgtcctgctcggcgacctg
gtcgacaccaagacgcgcaagaacctgaccgaggcgcgcatggccgagatcaacaaggtc
gatttcgccagcctgccgctcaacaacgcgatcaagtacgtgaagggcaacggcgcgcgc
aagatcgctgtgttctcggatccgaactgcccctactgcaagcgcttcgaatcgacgctg
cagtcgatggacaacatcaccgtctataccttcctctacccggtgctgacgcccgattcg
acggtcaagtcgaaggcgatctggtgcgcctcggatcgcgccaagagctgggagaactgg
atggtcggccatcagccgccgagcggcgccggcaactgcgacacctcggcgctcgacaag
aacctggcgctgggacgtggcctgaacgtgacgggcacgcccaccatcatcctggcggac
ggcacgcgcctgccgggcgcggtgtccgccgaccagctcaacagcgcgctggccgccgtc
aagtga

DBGET integrated database retrieval system