KEGG   Burkholderia gladioli BSR3: bgla_1g04730Help
Entry
bgla_1g04730      CDS       T01464                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bgd01100  Metabolic pathways
bgd01110  Biosynthesis of secondary metabolites
bgd01130  Biosynthesis of antibiotics
bgd01230  Biosynthesis of amino acids
Module
bgd_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    bgla_1g04730
Enzymes [BR:bgd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     bgla_1g04730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C KNTase_C
Motif
Other DBs
NCBI-ProteinID: AEA59166
UniProt: F2L7G1
Position
1:complement(523613..524398)
Genome map
AA seq 261 aa AA seqDB search
MSDILNRIIGVKREEIAAALQSTPLEALRLEAETRDLRDFVGALRARHAAGQSAVIAEVK
KASPSKGVLREHFVPAEIAASYAQHGAACLSVLTDEQFFQGSARYLKEAREACELPVLRK
DFIVDAYQVLEARAMGADAILLIAAALDTPQMQDLEAYAHSLGLAVLVEVHDRDEMNEAL
TLKTPLIGINNRNLRTFETTIETTLGMLDMVPADRIVVTESGILARADVERMKAADVHCF
LVGEAFMRAEQPGEELARMFF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacatcctcaaccgaatcattggcgtcaagcgtgaggaaatcgccgccgcgctg
cagagcacgccgctcgaagccctcaggctggaagccgaaacccgcgatctgcgcgacttc
gtcggcgcgctgcgcgccaggcacgcggccggccagtccgccgtgatcgccgaggtgaag
aaggccagcccctccaagggcgtgctgcgcgagcatttcgtgccggccgagatcgccgcc
tcgtatgcgcagcacggcgcggcctgcctgtcggtgctgaccgacgagcagttcttccag
ggcagcgcgcgttatctcaaggaagcccgcgaagcttgcgagctgccggtgctgcgcaag
gatttcatcgtcgacgcctaccaggtactcgaagcgcgcgcgatgggcgccgacgcgatc
ctgctgatcgccgccgcgctggacacaccgcagatgcaggacctggaagcctatgcgcat
tcgctgggcctggcggtgctggtcgaggtgcatgaccgcgacgagatgaacgaggcgctc
acgctgaagacgccgctgatcggcatcaacaaccgcaacctgcgcactttcgagaccacc
atcgagaccacgctgggcatgctcgacatggtgccggccgatcgcatcgtggtgaccgaa
tcgggcatcctcgcgcgcgccgacgtggaacgcatgaaggcggccgacgtgcactgcttc
ctggtcggcgaggccttcatgcgcgccgagcaaccgggcgaggaactcgcccggatgttc
ttctga

DBGET integrated database retrieval system