KEGG   Burkholderia gladioli BSR3: bgla_1g04850Help
Entry
bgla_1g04850      CDS       T01464                                 

Definition
(RefSeq) hypothetical protein
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    bgla_1g04850
  Carbohydrate metabolism
   00640 Propanoate metabolism
    bgla_1g04850
   00650 Butanoate metabolism
    bgla_1g04850
  Lipid metabolism
   00071 Fatty acid degradation
    bgla_1g04850
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    bgla_1g04850
   00310 Lysine degradation
    bgla_1g04850
   00360 Phenylalanine metabolism
    bgla_1g04850
   00380 Tryptophan metabolism
    bgla_1g04850
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    bgla_1g04850
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    bgla_1g04850
   00281 Geraniol degradation
    bgla_1g04850
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    bgla_1g04850
   00627 Aminobenzoate degradation
    bgla_1g04850
   00930 Caprolactam degradation
    bgla_1g04850
Enzymes [BR:bgd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     bgla_1g04850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:535835..536629
Genome map
AA seq 264 aa AA seqDB search
MIEEKSMDYQNILVETRGRVGLITLHRPKALNALNDALMDELGAALKAFDADEGIGAIVL
TGSEKAFAAGADIGMMANYSYMDAYKGDYITRNWETIRQIRKPIIAAVAGFALGGGCELA
MMCDIIIAADTAKFGQPEIRLGVMPGAGGTQRLPRAVSKAKAMDMCLTARFMEAAEAERA
GLVSRVVQAASLLDDALAAAATISEFSLPAVMMVKESVNRAYETTLAEGVTFERRLFHST
FATEDQKEGMAAFVEKRKPVFKHR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgaggagaaatcgatggattaccagaacatcctggtggagacccgggggcgtgtc
ggcctgatcacgctgcatcgtccgaaggcgctcaacgcgctcaacgatgcgctgatggac
gagctcggcgcggcactgaaggccttcgacgccgacgaagggatcggggcgatcgtgctg
accggcagcgagaaggcgttcgcggccggcgccgacatcgggatgatggcgaactactcc
tatatggatgcctacaagggcgactacatcacgcgcaactgggagacgatccggcagatc
cgcaagccgatcatcgcggcggtggcggggttcgcgctgggcggtggctgtgagctggcg
atgatgtgcgacatcatcatcgccgccgacacggcgaagttcggccagcccgagattcgg
ctcggcgtgatgccgggcgcgggcggcacgcagcgcctgccgcgcgcggtgtcgaaggcc
aaggcgatggacatgtgcctgaccgcgcgcttcatggaggcggcggaggccgagcgggcc
gggctggtgtcgcgcgtggtgcaggcggcgtcgctgctcgacgatgccctggccgcggcc
gcgacgatctccgagttctccctgccggccgtgatgatggtgaaggagtcggtgaatcgt
gcgtacgaaacgacgctggcggaaggcgtgacgttcgagcggcgcctgttccattcgacg
ttcgccaccgaggaccagaaggagggaatggcggcgttcgtggagaagcgcaagccggtg
ttcaagcatcgctga

DBGET integrated database retrieval system