KEGG   Burkholderia gladioli: bgla_1g05230Help
Entry
bgla_1g05230      CDS       T01464                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bgd  Burkholderia gladioli
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bgd01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bgd00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:585181..586299
Genome map
AA seq 372 aa AA seqDB search
MRSIIADSKRLVVKVGSSLVTNDGRGLDHAAIGRWAAQIAALREAGKEVVLVSSGAIAEG
MQRLGWSKRPREIDELQAAAAVGQMGLAQVYESRFAEHGIRTAQILLTHADLADRERYLN
ARSTLLTLLRLGVVPIINENDTVVTDEIKFGDNDTLGALVANLIEGDALVILTDQSGLFT
ADPRKDPAATLVQEADAGASELEAMAGGAGSSLGRGGMLTKILAAKRAAHSGANTVIASG
RETEVLVRLAAGEAIGTQLIARTARMAARKQWMADHLQVRGHVVIDAGAVEKLTAGGKSL
LPIGIVAVQGVFARGEVIACVNDAGREIARGLTNYSSAETKLIQRKPSGEIEMVLGYMLE
PELIHRDNLVLV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcgatcatcgccgattcgaagcgattggttgtgaaggtgggttccagcctcgtc
accaacgacgggcgcgggctcgatcatgcggcgatcggccgttgggcggcgcagatcgcg
gcgctgcgcgaggccggcaaggaggtcgtgctggtcagctcgggcgcgatcgccgagggc
atgcagcggctcggctggagcaagcggccacgcgagatcgacgagttgcaggccgcggcc
gcggtcggccagatggggctcgcgcaggtctacgagagccgcttcgccgagcacggcatc
cgcaccgcgcagatcctgctgacccacgccgatctggccgaccgcgaacgctacctcaac
gcgcgctcgaccctgctgacgctgctgcgcctgggcgtggtgccgatcatcaacgagaac
gacacggtggtcaccgacgaaatcaagttcggcgacaacgacacgctcggcgcgctggtc
gcgaacctgatcgagggcgatgcgctggtgatcctgaccgaccagtcgggcctgttcacc
gccgatccgcgcaaggacccggccgccaccctggtgcaggaagccgatgcgggcgcgtcc
gagctcgaggcgatggccggtggcgccggctcgagcctgggccggggcggcatgctgacc
aagatcctggccgccaagcgtgccgcgcacagcggcgccaacacggtgatcgcgagcggc
cgcgagaccgaggtgctggtgcggctggccgcgggcgaggcgatcggcacccagctgatc
gcgcgcaccgcgcgcatggccgcgcgcaagcaatggatggccgaccacctgcaggtgcgt
ggccacgtggtgatcgacgccggcgcggtcgagaagctgacggccggcggcaagagcctg
ctgccgatcggtatcgtcgcggtgcagggcgtgttcgcgcgcggcgaggtgattgcctgc
gtcaacgatgctggtcgcgagatcgcgcgcggcctgacgaactacagcagcgcggaaacc
aagctgatccagcgcaagccgagcggcgagatcgagatggtgcttggctacatgctcgag
cccgagctgatccaccgcgacaacctggttcttgtctga

DBGET integrated database retrieval system