KEGG   Burkholderia gladioli: bgla_1g05660Help
Entry
bgla_1g05660      CDS       T01464                                 

Definition
hypothetical protein
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
bgd  Burkholderia gladioli
Brite
Enzymes [BR:bgd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     bgla_1g05660
Transfer RNA biogenesis [BR:bgd03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    bgla_1g05660
 Prokaryotic Type
    bgla_1g05660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:630703..631125
Genome map
AA seq 140 aa AA seqDB search
MTRKWLRNGALASVFALIALGSAGLPAGGPVSSAYAREIAPTGAAVGTIATSSLPREAVT
TLGLIASGGPYPYSKDGVVFGNFERILPKMRRGYYHEYTVPTPRARNRGAKRIVCGGPLR
RIDNCYYSDDHYASFKRIVE
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcaagtggctccgcaacggcgcgctcgcgtcagtcttcgcgctcatcgcactg
ggtagcgccggcttgccggcgggcggtccggtttcttccgcctacgcacgggaaatcgcg
cccacgggcgcggcggtcggtacgattgcgacctcctcgctgccgcgcgaagccgtgacg
acgctcgggctgattgcttcaggcggcccctatccgtattcgaaagacggcgtcgtgttc
ggcaacttcgagcgcatcctgccgaagatgcggcgcggctattaccatgagtacacggtg
ccgacgccccgcgcgcgcaatcgcggcgcgaaacggatcgtctgcggcgggccgctgcgc
cggatcgacaactgttactactccgacgaccactacgccagttttaaacgtattgttgaa
tga

DBGET integrated database retrieval system