KEGG   Burkholderia gladioli: bgla_1g06170Help
Entry
bgla_1g06170      CDS       T01464                                 

Definition
Holliday junction resolvasome, DNA-binding subunit
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bgd  Burkholderia gladioli
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    bgla_1g06170
Enzymes [BR:bgd01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     bgla_1g06170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(682138..682719)
Genome map
AA seq 193 aa AA seqDB search
MIGRIAGTLLEKNPPHLLVDCNGVGYELDVPMSTFYNLPHTGERVVLLTQLIVREDAHLL
YGFLTPQERTTFRELLKISGIGARMALAVLSGMSVQELSQVVTLQDSARLTRLPGIGKKT
AERLLLELKGKLGADLGELAGQASQSDHAADILNALLALGYSEKEALAAIKNVPAGTGVS
DGIKLSLKALSKA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcgcattgccggcaccctgctcgaaaagaatccgccccacctgctcgtggac
tgcaacggcgtcggctacgagctcgacgtgccgatgagcaccttctacaacctgccgcac
acgggcgagcgcgtggtgctgctcacccagctgatcgtgcgcgaggatgcccacctgctg
tacggcttcctgaccccgcaggagcgcaccaccttccgcgagctgctgaagatcagcggg
atcggcgcgcgcatggcgctggccgtgctctccggcatgagcgtgcaggagctctcgcag
gtggtcaccctgcaggacagcgcgcgcctcacgcgcctgcccggcatcggcaagaagacc
gccgagcgcctgctgctggagctcaagggcaagctcggcgccgatctcggcgaactggcc
ggccaggcctcgcagtcggaccacgcggccgacatcctcaacgcgctgctcgcgctcggt
tattcggaaaaggaagcgctggccgcgatcaagaacgtgccggccggcaccggcgtgtcc
gacggcatcaagctctcgctgaaggcgctctcgaaggcctga

DBGET integrated database retrieval system