KEGG   Burkholderia gladioli BSR3: bgla_1g08290Help
Entry
bgla_1g08290      CDS       T01464                                 

Definition
(GenBank) Protein-L-isoaspartate O-methyltransferase, putative
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bgd  Burkholderia gladioli BSR3
Brite
Enzymes [BR:bgd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     bgla_1g08290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 MTS PrmA Methyltransf_11 Methyltransf_23 Ubie_methyltran Methyltransf_12 RrnaAD Methyltransf_18 Met_10 ADH_zinc_N Methyltransf_32 Cons_hypoth95 UPF0146 DUF43 UPF0020 TPMT tRNA_U5-meth_tr Methyltransf_4 CMAS Methyltransf_24 Methyltransf_9 DUF938 Methyltr_RsmB-F Methyltransf_16 Methyltransf_PK Spermine_synth
Motif
Other DBs
NCBI-ProteinID: AEA59517
UniProt: F2L9C3
Position
1:complement(931207..931860)
Genome map
AA seq 217 aa AA seqDB search
MNIDNARFNMIEQQIRPWEVLDPEVLSLLSVVKRELYVPSVYRDLAFADLELPLPGGQKM
LAPRVEARMLQELAVKKHESILEIGAGSGYMAALLAHRGQHVVTVDIDPALVQFATDNLR
DNGVSNAEVVLADAARGLPEKGPYDVICVSGGLPVVPQELLEQLKVGGRLAAFVGSRPVM
KAQIITRIDDKQFRVADVFETYVDHLVNAMEPSRFKF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcgacaatgcgcgtttcaacatgatcgaacagcagatccggccgtgggaagtg
ctggaccctgaggtcctgagcctgctgtcggtcgtcaagcgcgagctgtacgtgccgagc
gtctaccgtgatctggccttcgccgatctggaactgccgctgccgggcggccagaagatg
ctggccccgcgcgtcgaggcgcgcatgctgcaggagctggcggtcaagaagcacgagagc
atcctcgagatcggcgccggctcgggctacatggccgccctgctggcccatcgcggccag
cacgtggtgacggtcgacatcgacccggccctggtgcagttcgccaccgacaaccttcgc
gacaacggcgtgagcaatgccgaggtggtactggccgacgcggcgcgcggcctgcccgag
aagggcccctacgacgtgatctgcgtctcgggcggcttgccggtggtgccgcaggagctg
ctcgagcagctgaaggtgggcggccggctggccgccttcgttggctcgcgcccggtcatg
aaggcgcagatcatcacgcgcatcgacgacaagcagttccgcgtcgccgacgtgttcgaa
acctacgtcgaccacctcgtcaacgccatggagccgtcgcgcttcaagttctga

DBGET integrated database retrieval system