KEGG   Burkholderia gladioli: bgla_1g08700Help
Entry
bgla_1g08700      CDS       T01464                                 

Definition
RpiR family glucokinase/transcriptional regulator
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bgd  Burkholderia gladioli
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    bgla_1g08700
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bgla_1g08700
   00052 Galactose metabolism
    bgla_1g08700
   00500 Starch and sucrose metabolism
    bgla_1g08700
   00520 Amino sugar and nucleotide sugar metabolism
    bgla_1g08700
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    bgla_1g08700
   00524 Butirosin and neomycin biosynthesis
    bgla_1g08700
Enzymes [BR:bgd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     bgla_1g08700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(970985..972898)
Genome map
AA seq 637 aa AA seqDB search
MSTGAQTKPAAGQHADGPRLLADVGGTNARFALETGPGEITQIRVYPGADYPTLTDAIRK
YLKDVKIGRVNHAAIAIANPVDGDQVRMTNHDWSFSIEATRRALGFDTLLVVNDFTALAM
ALPGLTDAQRQQIGGGTRRQNSVIGLMGPGTGLGVSGLIPADDRWIALGSEGGHASFAPM
DEREDLVMQYARKKWPHVSFERVCAGPGIEIVYRALAGRDKKRVPANFGTPEIVERAHEG
DALALEAVDVFCAILGTFAGNLAVTLGALGGVYIGGGVVLKLGELFLKSRFRERFESKGR
FSDYCANVPTYLITADYPAFLGVSAILAEQLSNRSGGASSAVFERIRQMRDALTPAERRV
ADLALNHPRSIINDPIVDIARKADVSQPTVIRFCRSLGCQGLSDFKLKLATGLTGTIPMS
HSQVHLGDTATDFGAKVLDNTVSAILQLREHLNFEHVEHAIDILNNARRIEFYGLGNSNI
VAQDAHYKFFRFGIPTIAYGDLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLDVAMQA
GAKVIAITSSNTPLAKRATVALETDHIEMRESQLSMISRILHLVMIDILAVGVAIRRAAP
NAEITEAVAQAKARAGEDESADVLDWLSHGAAPATRD
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgtctactggtgcgcaaactaaaccggctgccggccagcacgccgacggcccgcgcctg
ctcgccgacgtcggcggcacgaacgcgcgcttcgcgctggagaccggccccggcgagatc
acgcagatccgcgtctatcccggcgccgactacccgacgctgaccgacgcgatccgcaag
tatctgaaggacgtcaagatcggccgcgtcaaccacgcggcgatcgcgatcgccaacccg
gtcgacggcgaccaggtgcggatgaccaaccacgactggagcttctcgatcgaggccacg
cgccgcgcgctgggcttcgacacgctgctggtggtcaacgacttcaccgcgctggcaatg
gccctgccgggcctgaccgacgcgcagcgccagcagatcggcggcggcacgcgccgccag
aacagcgtgatcggcctgatgggcccgggcaccggcctgggcgtgtcggggctgatcccc
gccgacgaccgctggatcgcactgggcagcgagggcggccatgccagcttcgcgccgatg
gacgagcgcgaggacctggtcatgcagtacgcgcgcaagaagtggccgcatgtctcgttc
gagcgcgtgtgcgccgggcccggcatcgagatcgtctatcgcgcgctggccgggcgcgac
aagaagcgcgtgcccgccaacttcggcacgcccgagatcgtcgagcgcgcgcatgaaggc
gacgcgctcgcgctcgaggcggtcgacgtgttctgcgcgatcctcggcaccttcgccggc
aatctggcggtcacgctcggcgcgctcggcggcgtgtacatcggcggcggcgtggtgctc
aagctcggcgagctgttcctgaagtcgcgctttcgcgagcgcttcgagtcgaagggccgc
ttctccgactattgcgcgaacgtgccgacctacctgatcacggccgactacccggccttc
ctcggcgtctcggcgatcctcgccgagcaactgtcgaaccgctcgggcggcgcctcctcg
gcggtgttcgagcggatccgccagatgcgcgatgcactgacgccggccgagcgacgcgtg
gccgacctcgcgctcaatcacccgcgctcgatcatcaacgacccgatcgtcgacatcgcg
cgcaaggccgacgtcagccagccgaccgtgatccgcttctgccgttcgctgggctgccag
ggcctgtcggacttcaagctgaagctggccaccggcctgaccggcacgatcccgatgagc
cacagccaggtgcacctgggcgacaccgccaccgacttcggcgcgaaggtgctcgacaac
accgtgtcggcgatcctgcagttgcgcgagcacctgaacttcgagcacgtcgagcatgcc
atcgacatcctcaacaatgcgcggcgcatcgagttctacggcctgggcaactcgaacatc
gtggcccaggacgcgcactacaagttcttccgcttcggcatcccgaccatcgcctacggc
gacctgtacatgcaggccgcctcggccgccctgctcggcaagggcgacgtgatcgtggcg
gtgtcgaagtcgggccgcgcgcccgagctgctgcgcgtgctcgacgtggcgatgcaggcc
ggcgccaaggtgatcgcgatcacctccagcaacacgccgctggccaagcgcgccaccgtg
gcgctcgagaccgaccacatcgagatgcgcgaatcgcagctgtcgatgatctcgcggatc
ctgcacctggtgatgatcgacatcctagcggtgggcgtggcgatccggcgcgccgcgccg
aacgccgagatcaccgaggcggtcgcgcaggcgaaggcgcgcgccggcgaggacgaatcg
gccgacgtgctcgactggctcagccacggcgcggccccggccacgcgcgactga

DBGET integrated database retrieval system