KEGG   Burkholderia gladioli: bgla_1g09130Help
Entry
bgla_1g09130      CDS       T01464                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bgd  Burkholderia gladioli
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    bgla_1g09130
Enzymes [BR:bgd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     bgla_1g09130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1018230..1018904
Genome map
AA seq 224 aa AA seqDB search
MIESNRDAHALHAGAYPGNLFMVVAPSGAGKSTLVNALLAKDSEICLSISYTTRKPRPGE
QDGEHYHFTSVEDFRARHARHEFLESAEVHGNYYGTSRVWIEEQMQSGRDVLLEIDWQGA
QQVKKQFRNAVGIFILPPSLAALEERLKKRGQDEPNVITRRLLAAGSEIAHASEAEYVVI
NEHFDTALSELQRIVAATRLRVASQYARHTELFIELGIHLPHAD
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaatcgaaccgagacgcgcatgcgctgcatgccggcgcgtatcccggcaacctg
ttcatggtggtggcgccctcgggcgcgggcaagtcgaccctggtgaacgcgctgctcgcc
aaggacagcgagatctgcctgtcgatctcgtacaccacgcgcaagccgcgtccgggcgag
caggacggcgagcactaccacttcaccagcgtcgaggatttccgcgcgcgccacgcgcgt
cacgaattcctggaaagcgccgaggtgcacggcaactactacgggacctcgcgcgtgtgg
atcgaggagcagatgcaaagcggtcgcgacgtgctgctcgagatcgactggcagggcgcg
cagcaggtcaagaagcagttccgcaacgcggtcggcatcttcatcctgccgccctcgctg
gcggcgctcgaggagcgactgaagaagcgcggccaggacgagccgaacgtgatcacgcgg
cgcctgctggccgccggcagcgagatcgcgcacgcctcggaagccgaatacgtggtgatc
aacgagcacttcgacacggcgctgtccgagctgcaacgcatcgtggcggccacgcgcctg
cgcgtggcctcgcaatacgcgcggcacaccgagcttttcatcgagctcggcatccatctc
ccgcacgccgactga

DBGET integrated database retrieval system