KEGG   Burkholderia gladioli: bgla_1g10570Help
Entry
bgla_1g10570      CDS       T01464                                 

Definition
beta-glucosidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bgd  Burkholderia gladioli
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    bgla_1g10570
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    bgla_1g10570
Enzymes [BR:bgd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     bgla_1g10570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1172479..1173507
Genome map
AA seq 342 aa AA seqDB search
MKPTPGPVMLDVVGTTLTRDDARRLAHPRTGGVILFARHFENRAQLCALTDAIRAVREDI
LIAVDHEGGRVQRFRTDGFTVLPAMRRLGELWDKDVLHATKLATAVGYVLAAELRACGID
LSFTPVLDLDYGRSKVIGDRAFHRDPRVVTLLAKSLNHGLALAGMANCGKHFPGHGFAEA
DSHVALPTDDRPLEQILKLDAAPYDWLGLSLSAVIPAHVIYTQVDARPAGFSSIWLQRVL
RERLGFTGAVFSDDLSMEAARAGGTLAQAADAALEAGCDMVLVCNQPEQAEKVLDEMQAE
VSAESARRIRRLRPRGKPASWDKLMRRPEYQRASALLRETLG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgactcccggccccgtcatgctcgatgtggtgggcaccaccctcacgcgcgac
gacgcgcgccgcctcgcgcatccgcgcacgggcggcgtgatcctgttcgcgcgccacttc
gagaaccgcgcccagctctgcgcgctgaccgacgcgatccgcgcggtgcgcgaggacatc
ctgatcgcggtcgaccacgaaggcggccgcgtgcagcgctttcgcaccgacggcttcacg
gtgctgccggcgatgcggcgcctgggcgagctgtgggacaaggacgtgctgcacgccacc
aagctcgccaccgcggtgggctatgtgctggccgccgagttgcgcgcctgcggcatcgac
ctgagcttcacgccggtgctcgatctcgactacggccgctcgaaggtgatcggcgatcgc
gccttccatcgcgatcctcgggtggtcacgctgctggccaagagcctcaaccacgggctc
gcgctggccggcatggcgaactgcggcaagcatttccccggccacggtttcgccgaggcc
gattcccacgtcgcgctgcctaccgacgatcgcccgctcgagcagatcctcaagctcgac
gcggcgccttatgactggctcggcctgtcgttgtcggcggtgatcccggcgcatgtgatc
tacacacaggtcgatgcgcgcccggccggtttctcgtcgatctggctgcagcgcgtgctg
cgcgagcggcttggcttcaccggcgccgtgttcagcgacgatctctcgatggaggcggcg
cgcgccggcggcacgctcgcgcaggctgccgacgcggcgctcgaggccggctgcgacatg
gtgctggtctgcaaccagcccgagcaggcggagaaggtgctcgacgagatgcaggcggag
gtgtcggccgagtcggcgcgccgtatccgccgcctgcgcccgcgcggcaagcccgccagc
tgggacaagctgatgcgccggcccgagtaccagcgtgcctctgccctgctgcgcgagacg
ctcggctga

DBGET integrated database retrieval system