KEGG   Burkholderia gladioli: bgla_1g11750Help
Entry
bgla_1g11750      CDS       T01464                                 

Definition
Exodeoxyribonuclease V, alpha subunit
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bgd  Burkholderia gladioli
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    bgla_1g11750
Enzymes [BR:bgd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     bgla_1g11750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1305963..1308275
Genome map
AA seq 770 aa AA seqDB search
MKDLTEPFGFVGGLAERLPEPADFGLALAEGFARRIGMLSRRLGAASDAARWAARAAFAA
SRATAAGHVCISLAALAERYATTLDAVRAELAASGVAAFGRAPRGADCPLVVDGEGRLYL
ARYYDYETRLADALVMHAGAASQADEAAFSPVALRESLERFFAAPRAGEIDWQRVAALVA
LGGRVTIVSGGPGTGKTTTVVGVIACLVEMQPALRIALAAPTGKAAQRMQEALHARASGL
PPELAARLPQTSYTLHRLLGWLPGGRFRHHRDNPLPYELVVVDEASMIDVALAAHLLDAL
APGARLVLLGDKDQLAAVEAGAVFAELSARPAFSAAGCRRIAQALGVEVADFVAALPSEA
GGPPVLAGAAPDAVTPPARPASTTTRTTARGKRKERDEADPSPAQASLFDFDEAPIVEPV
ALPAVSIDSFAGAPLDAWIEPEELGWLDAWRIDEQDVGGAAMNRETRTWVPGTGLEPAPP
VGAISPLADCVVWLERNYRFGLDSPIGRLSLAIRRGAAQDALDALSTEAGAAARYYDDSG
DALSAATIERLAHGFDAYGEALRAALATAEPDPLPLFDALNRFRILCATRSGARGADEVN
QRVAAQVRRAVRVPLAVGAHWFAGRPVMVTRNDYALGLFNGDIGIALPDARGALRVWFRG
ADGQARAVSPAALPPHDTAFALTVHKSQGSEFDEAALVLPAAFGRVLSRELVYTAITRAR
SRVQVIGPRTVLAQAIATRTQRDSGLAARIAEAAARHAGAGKTVDQENGT
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacctgaccgaaccgttcggcttcgtcggcgggctggccgaacgcctgcccgag
ccggccgatttcgggctcgcgctggccgagggtttcgcgcgccggatcggcatgctgtcg
cgccggctgggcgccgcctccgatgccgcgcgctgggccgcgcgcgcggccttcgcggcc
agccgcgcgaccgccgccggccatgtctgcatctcgctggcggcgctggccgaacgctac
gccaccacgctcgacgcggtgcgcgccgagcttgccgccagcggcgtggccgccttcggc
cgcgcgccgcgcggcgccgattgcccgctggtggtggacggggaagggcggctttatctc
gcgcgctattacgactacgagacgcgcctggccgatgcgctggtgatgcacgcgggcgcg
gcctcgcaagcggacgaggccgcgttctcgcctgtcgcgctgcgcgagagcctcgagcgc
ttcttcgcggcgccgcgcgcgggcgagatcgactggcaacgcgtcgccgccctggtcgcg
ctgggcgggcgggtgacgatcgtcagcggcggtcccggcaccggcaagaccaccaccgtg
gtgggcgtgatcgcctgcctggtggagatgcaaccggcgctgcggatcgcgctggccgcg
ccgaccggcaaggccgcgcagcgcatgcaggaggccctgcatgcgcgcgcctcgggcctg
ccgccggaactcgcggcgcgcctgccgcaaacctcctacacgctgcatcgcctgctcggc
tggctgccgggcgggcgcttccgccatcatcgcgacaatccgctgccttacgagctggtg
gtggtcgacgaggcctcgatgatcgatgtcgcgctcgccgcgcacctgctcgacgcgctg
gcgccgggcgcgcggctggtgctgctcggcgacaaggaccagctcgccgccgtcgaggcc
ggcgccgtgttcgccgagctgagcgcgcggccggccttcagcgcggcgggctgccggcgc
atcgcgcaggcgctgggcgtggaggtggcggacttcgtggcggcgctgccgtcggaggcg
ggcgggccgccggtgctggctggagcggcacctgatgcggtgacgccgcccgccaggccg
gcttcgacgaccacgcgcacgacggcgcgcggcaagcgcaaggagcgtgacgaagcggac
ccgtcgccggcgcaggcttccctgttcgatttcgacgaggcgccgatcgtcgagccggtc
gcgctgcccgcggtatcgatcgacagcttcgcgggcgcgccgctcgatgcctggatcgag
cctgaggaactgggctggctcgatgcctggcggatcgacgagcaggacgtcgggggcgcc
gcgatgaatcgggagacgcgaacttgggtgccggggaccggactcgaaccggcacctccc
gtcggcgccatctcccccctggccgactgcgtcgtctggctcgaacgcaactaccgcttc
ggcctcgattcgccgatcggccggctgtcgctggcgatccgccgcggcgcggcgcaggac
gcgctagacgcgctgtcgacggaagccggcgccgccgcgcgctactacgacgacagcggc
gacgccttgtccgccgccaccatcgagcgcctcgcgcacggtttcgacgcctatggcgag
gccttgcgcgcggcgctcgccacggccgagcccgatccgctgccgctgttcgacgcgctg
aaccgcttccgcatcctgtgcgccacccgcagcggcgcgcgcggcgccgacgaggtcaac
cagcgcgtcgccgcccaggtgcgtcgcgcggtgcgcgtgccgctcgcggtcggcgcgcac
tggttcgcgggccgacccgtgatggtcacgcgcaacgactacgcgctcggcctgttcaac
ggcgatatcggcatcgcgctgcccgatgcgcgcggcgcgctgcgggtctggttccgcggc
gccgacgggcaggcacgcgcggtctcgccggccgcgctgccgccccacgatacggccttc
gcgctgacggtccacaagtcgcagggttcggagttcgacgaggcggcgctggtcctgccg
gccgcgttcgggcgcgtgctgtcgcgcgagctggtctataccgcgatcacgcgcgcgcgt
tcacgggtgcaggtgatcgggccgcgcacggtgctggcgcaggcgatcgccacgcgcacc
cagcgcgactcgggccttgccgcgcggatcgccgaggccgccgcgcggcacgccggcgcc
ggcaagacagtcgatcaggagaacggaacatga

DBGET integrated database retrieval system