KEGG   Burkholderia gladioli: bgla_1g14680Help
Entry
bgla_1g14680      CDS       T01464                                 

Definition
Scyllo-inosamine-4-phosphate amidinotransferase
Orthology
K00613  
glycine amidinotransferase [EC:2.1.4.1]
Organism
bgd  Burkholderia gladioli
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bgd00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bgd00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1635179..1636297)
Genome map
AA seq 372 aa AA seqDB search
MTRFDMSEATEIVAGQVADEHGIPAGVWSCNEWDPLVEVVVGNPFNARFPYRDKSSHIAE
YAGKPFEAIPEGPFPKKVIEETEEDLGAMVGVFSKLGISVKRPDTWDHEQEFSTAYWKTK
GYYNYCPRDILLVVGDQIIETPNVIRGRSQETYSYRRILLEYLKDGSRWYSAPRPMLQDS
LFDVDHEKPVPRNDEPVFDAANVIRLGRDLLYLISSTGNDLGAHWLQTVLGKDFKVHVCR
LNYYGSHIDTSVVALRPGLLLCNPDRVSKDMLPDIFNDWEVLFSPPMVGADRFEPDYLSK
CIGSNWIDMNLFSLSSDLVMVDRDQLPLIRLLESKNIEVVPMKLRHSRMLGGGFHCTTLD
VKRKGTMESYFD
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgacgaggttcgatatgagtgaagcgactgaaatcgttgctggtcaggtagcggacgaa
catggaatccctgcgggcgtctggagttgcaacgagtgggatccgctagtggaagtggtc
gtcggaaatcctttcaacgcccgatttccgtatcgggacaagagcagtcacatcgcggag
tacgcgggcaagccgttcgaggcgattcccgaagggccgttcccgaaaaaggtgatcgag
gaaacagaagaggatcttggtgcgatggtcggcgtattctcgaagctcggaatatcggta
aagcgcccggacacatgggatcacgaacaggagttttccaccgcctactggaaaaccaag
ggctactacaattattgtccgcgcgacatactgctcgtcgtcggcgatcagatcatcgaa
accccgaacgtaattcgcggccggtctcaggaaacctacagctaccggcgaatcctgctt
gagtatctcaaggacggctcgcgctggtatagcgcgccgagaccgatgctgcaggactcg
ctgttcgatgtcgatcacgagaagcctgttccgcgcaacgatgagcccgtcttcgacgcg
gcgaacgtgattaggctcggaagagaccttctatatctgatcagttcaaccggcaacgac
ctcggcgcgcattggctgcagactgtcctcggaaaagatttcaaggttcatgtttgccgg
cttaactactatggcagtcacattgacacatccgtcgtggcgctacgcccgggtctgctg
ctttgcaatccagaccgcgtcagcaaggacatgcttccagacatattcaatgactgggaa
gtgctgttcagtccaccgatggttggcgctgaccgattcgaacctgactatttgtcgaaa
tgcatcggaagtaactggatcgatatgaatcttttcagcctcagctccgatcttgtaatg
gttgaccgtgatcaacttcccttgattcgcctgctcgaaagcaaaaatatcgaagtggtg
ccgatgaaacttcgacattcgagaatgctggggggcgggttccactgcacgacgctggat
gtcaaacgaaaagggacaatggagtcctacttcgattga

DBGET integrated database retrieval system