KEGG   Burkholderia gladioli: bgla_1g17010Help
Entry
bgla_1g17010      CDS       T01464                                 

Definition
Di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bgd  Burkholderia gladioli
Brite
Enzymes [BR:bgd01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     bgla_1g17010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1916121..1917518
Genome map
AA seq 465 aa AA seqDB search
MRSVHEDLARPWPDRHPFAVRAVAIVSLALACLLSACDSRAPQAAGDQAAAASAASQSTA
QAGASQAAGNEIVVANQPQTRAQVYAAVKKMTALGKQMFFDPALSGSGKLACASCHSPDH
AFGSPNGLSVQLGGDDLHQQGFRAVPTLMYLQKVPPFTRHFHDSDEEGDESVDAGPTGGL
TWDGRVDRGEQQARIPLTTRFEMNSTPAKVASAVRAAPYLADFRATFGDKVLSDDMATFN
AVLQALGTYEQTPEVFTPYTSKYDAFLDHKARLTAAEMRGLELFNDERKGNCASCHISQR
ALDGSPPQFSDFGLIALGVPRNRELAVNKDPKFHDLGACGPERQDLKGEDEFCGIFRTPT
LRNVVLKKAFFHNGIYHSLDEVLRFYVQRDTNPERFYPVRHGVVQKYDDLPKRYWANINT
DPPFDRKKGEKPALDEAEIQDVIAFLHTLTDGYRPDAQQQKVAAR
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagcgtgcacgaagacctcgcccggccttggccggatcgccaccccttcgccgtc
cgggcggtcgcgatcgtctcgcttgcgctcgcctgcctgctgagtgcctgcgattcgcgc
gcgccgcaggccgcgggcgatcaggccgccgcggcatcggccgcctcgcaatcgacggcg
caggccggcgcgtcgcaagcggccggcaacgagatcgtggtggctaaccagccgcagacg
cgcgcgcaggtctacgccgctgtcaagaaaatgacagcactgggtaagcagatgtttttc
gatccggcgctctcgggttccggaaagcttgcatgcgcttcctgccatagccccgaccat
gctttcggttcgcctaacggcctatctgtgcaattgggcggcgacgatctccatcagcag
ggtttccgcgccgtgccgacgctgatgtatctgcagaaggtgccgccgttcacgcggcac
ttccatgattcggacgaggagggcgacgagagcgtcgatgcgggtccgaccggcggcttg
acctgggatggccgcgtcgatcgcggcgagcagcaggcgcgcattccgctgaccacgcgc
ttcgagatgaacagcacgccggccaaggtggccagcgcggtgcgcgccgcgccctatctc
gcggatttccgcgcgaccttcggcgacaaggtgctgtccgacgacatggccaccttcaac
gcggtgctgcaggcgcttggcacctacgagcagacgccggaagtcttcacgccctacacc
agcaagtacgacgccttcctcgaccacaaggccaggctgacggccgccgagatgcgcggc
ctcgaactgttcaacgacgaacgcaagggcaattgcgcgagctgccatatcagccagcgc
gcgcttgacggctcgccgccgcagttcagcgatttcggcctgatcgcgctgggcgtgccg
cgcaatcgcgagctggcggtcaacaaggatccgaagttccatgacctgggcgcctgcggg
ccggagcgccaggacctgaagggcgaggacgagttctgcggcatcttccgcacgccgacg
ctgcgcaacgtggtgctgaagaaggccttcttccacaacggcatctatcactcgctcgat
gaggtgctgcgtttctacgtgcagcgcgataccaaccccgagcgcttctatccggtgcgt
cacggcgtggtgcagaagtacgacgatctgccgaaacgctattgggccaacatcaatacc
gatccgcccttcgatcgcaagaagggcgagaagccggcgctcgacgaggcggagatccag
gacgtgatcgccttcctgcacacgctcacggacggctaccgacccgatgcgcagcagcag
aaggtcgcggcgcgctga

DBGET integrated database retrieval system