KEGG   Burkholderia gladioli: bgla_1g17440Help
Entry
bgla_1g17440      CDS       T01464                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bgd  Burkholderia gladioli
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    bgla_1g17440
   00052 Galactose metabolism
    bgla_1g17440
   00500 Starch and sucrose metabolism
    bgla_1g17440
   00520 Amino sugar and nucleotide sugar metabolism
    bgla_1g17440
Enzymes [BR:bgd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     bgla_1g17440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1964108..1964989)
Genome map
AA seq 293 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIAAGITEMIFVTGRS
KRAIEDHFDKSYEVEAELEARGKEKLLELVRSIKPANVDCFYVRQPEALGLGHAVLCAEK
LVGDNPFAVILADDLLDGQPPVMKQMVDTFDHYHSSIIGVEEIPASDTKSYGIVDGKEWE
ESIVKLSGIVEKPAPEDAPSNLGVVGRYILKPRIFEHLRAIKPGAGGEIQLTDAIQALLA
DEQVLAYKYEGTRFDCGSKLGYLKATVEFALRHPEVRDEFEQYLRERGTSQSV
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaagtcactaaggcggtatttccggttgccggtctcggcacccgcttcctgccg
gcgacgaaggcaagcccgaaagaaatgctgcccgtcgtcgacaagcccttgatccagtat
gccgtcgaggaggcgatcgcggccggcatcaccgagatgatcttcgtcaccgggcgcagc
aagcgcgccatcgaggatcacttcgacaagtcctacgaagtcgaggccgaactcgaggca
cgcggcaaggagaagctgctcgagctggtgcgcagcatcaagcccgccaatgtcgactgc
ttctacgtgcgccagcccgaggcgctcggcctcggccacgccgtgctctgcgccgagaag
ctggtcggcgacaatcccttcgccgtgatccttgccgacgatctgctcgacgggcaaccg
cccgtcatgaagcagatggtcgataccttcgaccactaccacagctcgatcatcggcgtg
gaagagatccccgcctcggacaccaagtcctacgggatcgtcgacggcaaggagtgggag
gagtcgatcgtcaagctctcgggcatcgtcgagaagccggcgcccgaggatgcgccctcg
aacctcggcgtggtcggccgctacatcctgaagccgcgcatcttcgagcacctgcgcgcg
atcaagcccggcgccggcggcgagatccagctgaccgacgcgatccaggccctgctggcc
gacgaacaggtgctggcctacaagtacgaaggcacgcgcttcgactgcggcagcaagctc
ggctacctgaaggcgaccgtcgagttcgcgctgcgccacccggaagtgcgcgacgagttc
gagcagtatctgcgcgaacgcggcacctcgcagtcggtgtaa

DBGET integrated database retrieval system